Recombinant Human BLOC1S2 Protein, GST-tagged

• Cat.No.: BLOC1S2-248H
• Product Overview: Human BLOC1S2 full-length ORF ( NP_776170.2, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: BLOC1S2 is a component of the ubiquitously expressed BLOC1 multisubunit protein complex. BLOC1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules (Starcevic and DellAngelica, 2004 [PubMed 15102850]).
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 42.4 kDa
• AA Sequence: MAAAAEGVLATRSDEPARDDAAVETAEEAKEPAEADITELCRDMFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BLOC1S2 biogenesis of lysosomal organelles complex-1, subunit 2 [ Homo sapiens ]
• Official Symbol: BLOC1S2
• Synonyms: BLOC1S2; biogenesis of lysosomal organelles complex-1, subunit 2; biogenesis of lysosome-related organelles complex 1 subunit 2; Biogenesis of Lysosome related Organelles complex 1 Subunit 2; BLOS2; centrosome protein oncogene; FLJ30135; MGC10120; BLOC-1 subunit 2; centrosomal 10 kDa protein; centrosome-associated protein; RP11-316M21.4
• Gene ID: 282991
• mRNA Refseq: NM_173809
• Protein Refseq: NP_776170
• MIM: 609768
• UniProt ID: Q6QNY1