Recombinant Human BLOC1S2 Protein, GST-tagged
Cat.No. : | BLOC1S2-248H |
Product Overview : | Human BLOC1S2 full-length ORF ( NP_776170.2, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | BLOC1S2 is a component of the ubiquitously expressed BLOC1 multisubunit protein complex. BLOC1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules (Starcevic and DellAngelica, 2004 [PubMed 15102850]). |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 42.4 kDa |
AA Sequence : | MAAAAEGVLATRSDEPARDDAAVETAEEAKEPAEADITELCRDMFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BLOC1S2 biogenesis of lysosomal organelles complex-1, subunit 2 [ Homo sapiens ] |
Official Symbol | BLOC1S2 |
Synonyms | BLOC1S2; biogenesis of lysosomal organelles complex-1, subunit 2; biogenesis of lysosome-related organelles complex 1 subunit 2; Biogenesis of Lysosome related Organelles complex 1 Subunit 2; BLOS2; centrosome protein oncogene; FLJ30135; MGC10120; BLOC-1 subunit 2; centrosomal 10 kDa protein; centrosome-associated protein; RP11-316M21.4; |
Gene ID | 282991 |
mRNA Refseq | NM_173809 |
Protein Refseq | NP_776170 |
MIM | 609768 |
UniProt ID | Q6QNY1 |
◆ Recombinant Proteins | ||
BLOC1S2-10241H | Recombinant Human BLOC1S2, GST-tagged | +Inquiry |
BLOC1S2-94C | Recombinant Cynomolgus Monkey BLOC1S2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BLOC1S2-990R | Recombinant Rat BLOC1S2 Protein | +Inquiry |
BLOC1S2-371R | Recombinant Rhesus Macaque BLOC1S2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Bloc1s2-1873M | Recombinant Mouse Bloc1s2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BLOC1S2-8443HCL | Recombinant Human BLOC1S2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BLOC1S2 Products
Required fields are marked with *
My Review for All BLOC1S2 Products
Required fields are marked with *