Recombinant Human BMP10 Protein, GST-tagged

Cat.No. : BMP10-258H
Product Overview : Human BMP10 partial ORF ( NP_055297, 317 a.a. - 424 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the TGF-beta family of growth factors. Data suggest that the similar protein in mouse plays an important role in trabeculation of the embryonic heart. In human, this protein may signal through receptor serine/threonine kinases.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.62 kDa
AA Sequence : NAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BMP10 bone morphogenetic protein 10 [ Homo sapiens ]
Official Symbol BMP10
Synonyms BMP10; bone morphogenetic protein 10; MGC126783;
Gene ID 27302
mRNA Refseq NM_014482
Protein Refseq NP_055297
MIM 608748
UniProt ID O95393

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BMP10 Products

Required fields are marked with *

My Review for All BMP10 Products

Required fields are marked with *

0
cart-icon