Recombinant Human BMP15 protein, His&Myc-tagged
Cat.No. : | BMP15-821H |
Product Overview : | Recombinant Human BMP15 protein(O95972)(268-392aa), fused to N-terminal His and C-terminal Myc tags, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 268-392aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 21.4 kDa |
AA Sequence : | QADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | BMP15 bone morphogenetic protein 15 [ Homo sapiens ] |
Official Symbol | BMP15 |
Synonyms | BMP15; bone morphogenetic protein 15; GDF9B; BMP-15; GDF-9B; growth/differentiation factor 9B; ODG2; POF4; |
Gene ID | 9210 |
mRNA Refseq | NM_005448 |
Protein Refseq | NP_005439 |
MIM | 300247 |
UniProt ID | O95972 |
◆ Recombinant Proteins | ||
BMP15-0777H | Recombinant Human BMP15 Protein (Thr266-Ser388), His tagged | +Inquiry |
BMP15-6433S | Recombinant Sheep BMP15 protein, His&Myc-tagged | +Inquiry |
BMP15-2687Z | Recombinant Zebrafish BMP15 | +Inquiry |
Bmp15-268R | Recombinant Rat Bmp15 Protein, His-tagged | +Inquiry |
BMP15-266H | Recombinant Human BMP15 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP15-66HCL | Recombinant Human BMP15 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP15 Products
Required fields are marked with *
My Review for All BMP15 Products
Required fields are marked with *