Recombinant Human BMP3 protein, Myc-tagged
| Cat.No. : | BMP3-2598H |
| Product Overview : | Recombinant Human BMP3 protein(P12645)(363-472aa), fused to C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Myc |
| Protein Length : | 363-472aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 13.9 kDa |
| AA Sequence : | QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | BMP3 bone morphogenetic protein 3 [ Homo sapiens ] |
| Official Symbol | BMP3 |
| Synonyms | BMP3; bone morphogenetic protein 3; bone morphogenetic protein 3 (osteogenic); osteogenin; BMP-3; bone morphogenetic protein-3; bone morphogenetic protein 3A; BMP-3A; |
| Gene ID | 651 |
| mRNA Refseq | NM_001201 |
| Protein Refseq | NP_001192 |
| MIM | 112263 |
| UniProt ID | P12645 |
| ◆ Recombinant Proteins | ||
| BMP3-655R | Recombinant Rat BMP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BMP3-265H | Recombinant Human BMP3 Protein, GST-tagged | +Inquiry |
| BMP3-12H | Recombinant Active Human BMP3 Protein, His-tagged(C-ter) | +Inquiry |
| BMP3-26427TH | Recombinant Human BMP3 | +Inquiry |
| BMP3-10251H | Recombinant Human BMP3, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BMP3-8433HCL | Recombinant Human BMP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP3 Products
Required fields are marked with *
My Review for All BMP3 Products
Required fields are marked with *



