Recombinant Human BMP4 Protein, GMP Grade, Animal-Free
Cat.No. : | BMP4-26HG |
Product Overview : | GMP Recombinant Human BMP4 protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials. E.coli-derived Human BMP-4 is a fully active homodimeric protein consisting of two 107 amino acid subunits, which correspond to amino acids 303-408 of the full length BMP-4 precursor, as well as an N-terminal Methionine. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 303-408 a.a. |
Description : | Bone morphogenetic proteins (BMPs) constitute a subfamily within the TGF-β superfamily of structurally related signaling proteins. Members of this superfamily are widely distributed throughout the body, and are involved in diverse physiological processes during both pre- and postnatal life. |
Molecular Mass : | 24.2 kDa |
AA Sequence : | MKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR |
Purity : | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
Full Length : | Full L. |
Gene Name | BMP4 bone morphogenetic protein 4 [ Homo sapiens (human) ] |
Official Symbol | BMP4 |
Synonyms | BMP4; bone morphogenetic protein 4; BMP2B; BMP-4; BMP-2B; bone morphogenetic protein 2B; ZYME; OFC11; BMP2B1; MCOPS6; |
Gene ID | 652 |
mRNA Refseq | NM_001202 |
Protein Refseq | NP_001193 |
MIM | 112262 |
UniProt ID | P12644 |
◆ Recombinant Proteins | ||
BMP4-001H | Recombinant Human BMP4 Protein, His-MBP-tagged | +Inquiry |
BMP4-02H | Recombinant Human BMP4 protein | +Inquiry |
BMP4-262H | Recombinant Human BMP4 protein, His-tagged | +Inquiry |
BMP4-02P | Recombinant Pig BMP4 Protein (Arg227-Cys408), C-His tagged, Animal-free, Carrier-free | +Inquiry |
Bmp4-572R | Recombinant Rat Bmp4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP4-8432HCL | Recombinant Human BMP4 293 Cell Lysate | +Inquiry |
BMP4-8431HCL | Recombinant Human BMP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BMP4 Products
Required fields are marked with *
My Review for All BMP4 Products
Required fields are marked with *
0
Inquiry Basket