Recombinant Human BMP4 Protein, GMP Grade, Animal-Free
| Cat.No. : | BMP4-26HG |
| Product Overview : | GMP Recombinant Human BMP4 protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials. E.coli-derived Human BMP-4 is a fully active homodimeric protein consisting of two 107 amino acid subunits, which correspond to amino acids 303-408 of the full length BMP-4 precursor, as well as an N-terminal Methionine. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Protein Length : | 303-408 a.a. |
| Description : | Bone morphogenetic proteins (BMPs) constitute a subfamily within the TGF-β superfamily of structurally related signaling proteins. Members of this superfamily are widely distributed throughout the body, and are involved in diverse physiological processes during both pre- and postnatal life. |
| Molecular Mass : | 24.2 kDa |
| AA Sequence : | MKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR |
| Purity : | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
| Full Length : | Full L. |
| Gene Name | BMP4 bone morphogenetic protein 4 [ Homo sapiens (human) ] |
| Official Symbol | BMP4 |
| Synonyms | BMP4; bone morphogenetic protein 4; BMP2B; BMP-4; BMP-2B; bone morphogenetic protein 2B; ZYME; OFC11; BMP2B1; MCOPS6; |
| Gene ID | 652 |
| mRNA Refseq | NM_001202 |
| Protein Refseq | NP_001193 |
| MIM | 112262 |
| UniProt ID | P12644 |
| ◆ Recombinant Proteins | ||
| BMP4-575R | Recombinant Rabbit BMP4 protein, His-tagged | +Inquiry |
| BMP4-2432M | Recombinant Mouse BMP4 Protein | +Inquiry |
| BMP4-1169B | Recombinant Bovine BMP4 protein, GST-tagged | +Inquiry |
| BMP4-23H | Recombinant Human Bone Morphogenetic Protein 4 | +Inquiry |
| Bmp4-14M | Recombinant Active Mouse BMP4 Protein, His-tagged(C-ter) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BMP4-8431HCL | Recombinant Human BMP4 293 Cell Lysate | +Inquiry |
| BMP4-8432HCL | Recombinant Human BMP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP4 Products
Required fields are marked with *
My Review for All BMP4 Products
Required fields are marked with *
