Recombinant Human BMP4 Protein, GMP Grade, Animal-Free

Cat.No. : BMP4-26HG
Product Overview : GMP Recombinant Human BMP4 protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials. E.coli-derived Human BMP-4 is a fully active homodimeric protein consisting of two 107 amino acid subunits, which correspond to amino acids 303-408 of the full length BMP-4 precursor, as well as an N-terminal Methionine.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 303-408 a.a.
Description : Bone morphogenetic proteins (BMPs) constitute a subfamily within the TGF-β superfamily of structurally related signaling proteins. Members of this superfamily are widely distributed throughout the body, and are involved in diverse physiological processes during both pre- and postnatal life.
Molecular Mass : 24.2 kDa
AA Sequence : MKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Purity : ≥ 98% by SDS-PAGE gel and HPLC analyses.
Full Length : Full L.
Gene Name BMP4 bone morphogenetic protein 4 [ Homo sapiens (human) ]
Official Symbol BMP4
Synonyms BMP4; bone morphogenetic protein 4; BMP2B; BMP-4; BMP-2B; bone morphogenetic protein 2B; ZYME; OFC11; BMP2B1; MCOPS6;
Gene ID 652
mRNA Refseq NM_001202
Protein Refseq NP_001193
MIM 112262
UniProt ID P12644

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BMP4 Products

Required fields are marked with *

My Review for All BMP4 Products

Required fields are marked with *

0
cart-icon