| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
139 |
| Description : |
Bone Morphogenetic Protein 7 is one of the BMPs, some of which belong to the TGF-beta superfamily (BMP2-7). There are more than thirteen BMPs have been discovered nowadays and they are involved in inducing cartilage and bone formation. BMP-7 is mainly expressed in kidney and bladder. It is also present in developing eyes, brain and ear during embryogenesis. BMP-7 also named osteogenic protein-1 (OP-1) is a potent osteoinductive cytokine and plays role in osteoblast differentiation, SMAD1 production and renal development and repair. Human BMP-7 is synthesized with a signal sequence (29 a.a.), a propeptide (263 a.a.), and a growth factor domain (139 a.a.). The growth factor domain of human BMP-7 shares 98 % a.a. sequence identity with mouse and rat BMP-7. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in 30 % acetonitrile, 0.1 % TFA. |
| Molecular Mass : |
Approximately 15.7 kDa, a monomeric, non-glycosylated polypeptide chain containing 139 amino acids. |
| AA Sequence : |
STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH |
| Endotoxin : |
Less than 1 EU/μg of rHuBMP-7 as determined by LAL method. |
| Purity : |
>95% by SDS-PAGE and HPLC analysis. |
| Applications : |
Molecular standard (Western, ELISA) in studying secreted BMP-7; Preparing antibodies for BMP-7 monomer; Molecule standard in detecting secreted BMP-7 in reduced SDS-PAGE. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10 mM HAc to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |