Recombinant Human BMP7 protein, GST-tagged
| Cat.No. : | BMP7-2601H |
| Product Overview : | Recombinant Human BMP7 protein(P18075)(293-431aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 293-431aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 42.7 kDa |
| AA Sequence : | STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | BMP7 bone morphogenetic protein 7 [ Homo sapiens ] |
| Official Symbol | BMP7 |
| Synonyms | BMP7; bone morphogenetic protein 7; OP 1; osteogenic protein 1; BMP-7; OP-1; |
| Gene ID | 655 |
| mRNA Refseq | NM_001719 |
| Protein Refseq | NP_001710 |
| MIM | 112267 |
| UniProt ID | P18075 |
| ◆ Recombinant Proteins | ||
| BMP7-508H | Active Recombinant Human BMP7, HIgG1 Fc-tagged, mutant | +Inquiry |
| BMP7-135H | Active Recombinant Human BMP7, Animal Free | +Inquiry |
| BMP7-11H | Recombinant Human BMP7 protein, His-tagged | +Inquiry |
| BMP7-207H | Recombinant Human BMP7 protein, His/S-tagged | +Inquiry |
| Bmp7-42M | Recombinant Mouse Bmp7 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BMP7-8429HCL | Recombinant Human BMP7 293 Cell Lysate | +Inquiry |
| CPB-1276RH | Rabbit Anti-Human BMP 7 Polyclonal Antibody | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP7 Products
Required fields are marked with *
My Review for All BMP7 Products
Required fields are marked with *




