Recombinant Human BMP7 protein, GST-tagged
Cat.No. : | BMP7-2601H |
Product Overview : | Recombinant Human BMP7 protein(P18075)(293-431aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 293-431aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.7 kDa |
AA Sequence : | STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | BMP7 bone morphogenetic protein 7 [ Homo sapiens ] |
Official Symbol | BMP7 |
Synonyms | BMP7; bone morphogenetic protein 7; OP 1; osteogenic protein 1; BMP-7; OP-1; |
Gene ID | 655 |
mRNA Refseq | NM_001719 |
Protein Refseq | NP_001710 |
MIM | 112267 |
UniProt ID | P18075 |
◆ Recombinant Proteins | ||
BMP7-0781H | Recombinant Human BMP7 Protein (Asp30-His431), His tagged | +Inquiry |
BMP7-3994H | Recombinant Human BMP7 protein, His-tagged | +Inquiry |
BMP7-1548H | Recombinant human BMP7, Active | +Inquiry |
BMP7-10H | Recombinant Human Bone Morphogenetic Protein 7, His-tagged | +Inquiry |
BMP7-26285TH | Recombinant Human BMP7, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPB-1276RH | Rabbit Anti-Human BMP 7 Polyclonal Antibody | +Inquiry |
BMP7-8429HCL | Recombinant Human BMP7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP7 Products
Required fields are marked with *
My Review for All BMP7 Products
Required fields are marked with *