Recombinant Human BMPER Protein, GST-tagged
| Cat.No. : | BMPER-277H |
| Product Overview : | Human BMPER full-length ORF ( NP_597725.1, 1 a.a. - 685 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 102.4 kDa |
| AA Sequence : | MLWFSGVGALAERYCRRSPGITCCVLLLLNCSGVPMSLASSFLTGSVAKCENEGEVLQIPFITDNPCIMCVCLNKEVTCKREKCPVLSRDCALAIKQRGACCEQCKGCTYEGNTYNSSFKWQSPAEPCVLRQCQEGVVTESGVRCVVHCKNPLEHLGMCCPTCPGCVFEGVQYQEGEEFQPEGSKCTKCSCTGGRTQCVREVCPILSCPQHLSHIPPGQCCPKCLGQRKVFDLPFGSCLFRSDVYDNGSSFLYDNCTACTCRDSTVVCKRKCSHPGGCDQGQEGCCEECLLRVPPEDIKVCKFGNKIFQDGEMWSSINCTICACVKGRTECRNKQCIPISSCPQGKILNRKGCCPICTEKPGVCTVFGDPHYNTFDGRTFNFQGTCQYVLTKDCSSPASPFQVLVKNDARRTRSFSWTKSVELVLGESRVSLQQHLTVRWNGSRIALPCRAPHFHIDLDGYLLKVTTKAGLEISWDGDSFVEVMAAPHLKGKLCGLCGNYNGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTVKVKLRAHRECQKLKSWEFQTCHSTVDYATFYRSCVTDMCECPVHKNCYCESFLAYTRACQREGIKVHWEPQQNCAATQCKHGAVYDTCGPGCIKTCDNWNEIGPCNKPCVAGCHCPANLVLHKGRCIKPVLCPQR |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BMPER BMP binding endothelial regulator [ Homo sapiens ] |
| Official Symbol | BMPER |
| Synonyms | BMPER; BMP binding endothelial regulator; BMP-binding endothelial regulator protein; CRIM3; crossveinless 2; Cv2; hCV2; crossveinless-2; BMP-binding endothelial regulator precursor protein; bone morphogenetic protein-binding endothelial cell precursor-derived regulator; CV2; CV-2; |
| Gene ID | 168667 |
| mRNA Refseq | NM_133468 |
| Protein Refseq | NP_597725 |
| MIM | 608699 |
| UniProt ID | Q8N8U9 |
| ◆ Recombinant Proteins | ||
| BMPER-277H | Recombinant Human BMPER Protein, GST-tagged | +Inquiry |
| BMPER-900H | Recombinant Human BMPER | +Inquiry |
| Bmper-1686M | Recombinant Mouse Bmper protein, His & T7-tagged | +Inquiry |
| Bmper-1057M | Recombinant Mouse Bmper Protein, His (Fc)-Avi-tagged | +Inquiry |
| Bmper-344M | Active Recombinant Mouse Bmper, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMPER Products
Required fields are marked with *
My Review for All BMPER Products
Required fields are marked with *
