Recombinant Human BMPER Protein, GST-tagged
Cat.No. : | BMPER-277H |
Product Overview : | Human BMPER full-length ORF ( NP_597725.1, 1 a.a. - 685 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 102.4 kDa |
AA Sequence : | MLWFSGVGALAERYCRRSPGITCCVLLLLNCSGVPMSLASSFLTGSVAKCENEGEVLQIPFITDNPCIMCVCLNKEVTCKREKCPVLSRDCALAIKQRGACCEQCKGCTYEGNTYNSSFKWQSPAEPCVLRQCQEGVVTESGVRCVVHCKNPLEHLGMCCPTCPGCVFEGVQYQEGEEFQPEGSKCTKCSCTGGRTQCVREVCPILSCPQHLSHIPPGQCCPKCLGQRKVFDLPFGSCLFRSDVYDNGSSFLYDNCTACTCRDSTVVCKRKCSHPGGCDQGQEGCCEECLLRVPPEDIKVCKFGNKIFQDGEMWSSINCTICACVKGRTECRNKQCIPISSCPQGKILNRKGCCPICTEKPGVCTVFGDPHYNTFDGRTFNFQGTCQYVLTKDCSSPASPFQVLVKNDARRTRSFSWTKSVELVLGESRVSLQQHLTVRWNGSRIALPCRAPHFHIDLDGYLLKVTTKAGLEISWDGDSFVEVMAAPHLKGKLCGLCGNYNGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTVKVKLRAHRECQKLKSWEFQTCHSTVDYATFYRSCVTDMCECPVHKNCYCESFLAYTRACQREGIKVHWEPQQNCAATQCKHGAVYDTCGPGCIKTCDNWNEIGPCNKPCVAGCHCPANLVLHKGRCIKPVLCPQR |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BMPER BMP binding endothelial regulator [ Homo sapiens ] |
Official Symbol | BMPER |
Synonyms | BMPER; BMP binding endothelial regulator; BMP-binding endothelial regulator protein; CRIM3; crossveinless 2; Cv2; hCV2; crossveinless-2; BMP-binding endothelial regulator precursor protein; bone morphogenetic protein-binding endothelial cell precursor-derived regulator; CV2; CV-2; |
Gene ID | 168667 |
mRNA Refseq | NM_133468 |
Protein Refseq | NP_597725 |
MIM | 608699 |
UniProt ID | Q8N8U9 |
◆ Recombinant Proteins | ||
BMPER-2552H | Recombinant Human BMPER Protein, His (Fc)-Avi-tagged | +Inquiry |
BMPER-1731C | Recombinant Chicken BMPER | +Inquiry |
Bmper-1686M | Recombinant Mouse Bmper protein, His & T7-tagged | +Inquiry |
BMPER-277H | Recombinant Human BMPER Protein, GST-tagged | +Inquiry |
BMPER-900H | Recombinant Human BMPER | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BMPER Products
Required fields are marked with *
My Review for All BMPER Products
Required fields are marked with *
0
Inquiry Basket