Recombinant Human BMPR1B protein, GST-tagged
Cat.No. : | BMPR1B-301364H |
Product Overview : | Recombinant Human BMPR1B (16-57 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
Source : | E. coli |
Species : | Human |
Tag : | GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Protein length : | Glu16-Ile57 |
AA Sequence : | EDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMI |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name : | BMPR1B bone morphogenetic protein receptor, type IB [ Homo sapiens ] |
Official Symbol : | BMPR1B |
Synonyms : | BMPR1B; bone morphogenetic protein receptor, type IB; bone morphogenetic protein receptor type-1B; ALK6; CDw293; BMPR-1B; BMP type-1B receptor; activin receptor-like kinase 6; serine/threonine receptor kinase; ALK-6; |
Gene ID : | 658 |
mRNA Refseq : | NM_001203 |
Protein Refseq : | NP_001194 |
MIM : | 603248 |
UniProt ID : | O00238 |
Products Types
◆ Recombinant Protein | ||
BMPR1B-376R | Recombinant Rhesus Macaque BMPR1B Protein, His (Fc)-Avi-tagged | +Inquiry |
BMPR1B-4369H | Recombinant Human BMPR1B Protein, His (Fc)-Avi-tagged | +Inquiry |
BMPR1B-5115H | Recombinant Human BMPR1B Protein (Met1-Arg126), C-His tagged | +Inquiry |
BMPR1B-548R | Recombinant Rhesus monkey BMPR1B Protein, His-tagged | +Inquiry |
BMPR1B-555H | Active Recombinant Human BMPR1B, Fc-tagged, Biotinylated | +Inquiry |
◆ Lysates | ||
BMPR1B-464HCL | Recombinant Human BMPR1B cell lysate | +Inquiry |
BMPR1B-1166HCL | Recombinant Human BMPR1B cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket