Recombinant Human BMPR1B protein, GST-tagged
| Cat.No. : | BMPR1B-301364H |
| Product Overview : | Recombinant Human BMPR1B (16-57 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Glu16-Ile57 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | EDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMI |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | BMPR1B bone morphogenetic protein receptor, type IB [ Homo sapiens ] |
| Official Symbol | BMPR1B |
| Synonyms | BMPR1B; bone morphogenetic protein receptor, type IB; bone morphogenetic protein receptor type-1B; ALK6; CDw293; BMPR-1B; BMP type-1B receptor; activin receptor-like kinase 6; serine/threonine receptor kinase; ALK-6; |
| Gene ID | 658 |
| mRNA Refseq | NM_001203 |
| Protein Refseq | NP_001194 |
| MIM | 603248 |
| UniProt ID | O00238 |
| ◆ Recombinant Proteins | ||
| BMPR1B-1589H | Recombinant Human Bone Morphogenetic Protein Receptor, Type IB | +Inquiry |
| BMPR1B-992H | Recombinant Human Bone Morphogenetic Protein Receptor, Type IB, GST-tagged | +Inquiry |
| BMPR1B-555H | Active Recombinant Human BMPR1B, Fc-tagged, Biotinylated | +Inquiry |
| BMPR1B-6689C | Recombinant Chicken BMPR1B | +Inquiry |
| BMPR1B-4369H | Recombinant Human BMPR1B Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BMPR1B-464HCL | Recombinant Human BMPR1B cell lysate | +Inquiry |
| BMPR1B-1166HCL | Recombinant Human BMPR1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMPR1B Products
Required fields are marked with *
My Review for All BMPR1B Products
Required fields are marked with *



