Recombinant Human BMPR1B protein, GST-tagged

Cat.No. : BMPR1B-301364H
Product Overview : Recombinant Human BMPR1B (16-57 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Glu16-Ile57
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : EDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMI
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name BMPR1B bone morphogenetic protein receptor, type IB [ Homo sapiens ]
Official Symbol BMPR1B
Synonyms BMPR1B; bone morphogenetic protein receptor, type IB; bone morphogenetic protein receptor type-1B; ALK6; CDw293; BMPR-1B; BMP type-1B receptor; activin receptor-like kinase 6; serine/threonine receptor kinase; ALK-6;
Gene ID 658
mRNA Refseq NM_001203
Protein Refseq NP_001194
MIM 603248
UniProt ID O00238

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BMPR1B Products

Required fields are marked with *

My Review for All BMPR1B Products

Required fields are marked with *

0
cart-icon
0
compare icon