Recombinant Human BORCS5 Protein, GST-tagged

Cat.No. : BORCS5-4738H
Product Overview : Human LOH12CR1 full-length ORF ( NP_477517.1, 1 a.a. - 196 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : BORCS5 (BLOC-1 Related Complex Subunit 5) is a Protein Coding gene.
Molecular Mass : 48.6 kDa
AA Sequence : MGSEQSSEAESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIPTFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKEMDLSVETLFSFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLLDRLNSMLPEGERLEPFSMKPDRELRL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BORCS5 BLOC-1 related complex subunit 5 [ Homo sapiens (human) ]
Official Symbol BORCS5
Synonyms BORCS5; BLOC-1 related complex subunit 5; LOH12CR1; LOH1CR12; BLOC-1-related complex subunit 5; loss of heterozygosity 12 chromosomal region 1 protein; loss of heterozygosity, 12, chromosomal region 1; myristoylated lysosomal protein; myrlysin
Gene ID 118426
mRNA Refseq NM_001300742
Protein Refseq NP_001287671
MIM 616598
UniProt ID Q969J3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BORCS5 Products

Required fields are marked with *

My Review for All BORCS5 Products

Required fields are marked with *

0
cart-icon
0
compare icon