Recombinant Human BORCS5 Protein, GST-tagged
Cat.No. : | BORCS5-4738H |
Product Overview : | Human LOH12CR1 full-length ORF ( NP_477517.1, 1 a.a. - 196 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | BORCS5 (BLOC-1 Related Complex Subunit 5) is a Protein Coding gene. |
Molecular Mass : | 48.6 kDa |
AA Sequence : | MGSEQSSEAESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIPTFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKEMDLSVETLFSFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLLDRLNSMLPEGERLEPFSMKPDRELRL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BORCS5 BLOC-1 related complex subunit 5 [ Homo sapiens (human) ] |
Official Symbol | BORCS5 |
Synonyms | BORCS5; BLOC-1 related complex subunit 5; LOH12CR1; LOH1CR12; BLOC-1-related complex subunit 5; loss of heterozygosity 12 chromosomal region 1 protein; loss of heterozygosity, 12, chromosomal region 1; myristoylated lysosomal protein; myrlysin |
Gene ID | 118426 |
mRNA Refseq | NM_001300742 |
Protein Refseq | NP_001287671 |
MIM | 616598 |
UniProt ID | Q969J3 |
◆ Recombinant Proteins | ||
BORCS5-4738H | Recombinant Human BORCS5 Protein, GST-tagged | +Inquiry |
BORCS5-5944HF | Recombinant Full Length Human BORCS5 Protein, GST-tagged | +Inquiry |
Borcs5-1882M | Recombinant Mouse Borcs5 Protein, Myc/DDK-tagged | +Inquiry |
BORCS5-2716H | Recombinant Human BORCS5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BORCS5 Products
Required fields are marked with *
My Review for All BORCS5 Products
Required fields are marked with *
0
Inquiry Basket