Recombinant Human BORCS5 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | BORCS5-2716H |
| Product Overview : | LOH12CR1 MS Standard C13 and N15-labeled recombinant protein (NP_477517) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor. Thereby, it may indirectly play a role in cell spreading and motility. |
| Molecular Mass : | 22.2 kDa |
| AA Sequence : | MGSEQSSEAESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIPTFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKEMDLSVETLFSFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLLDRLNSMLPEGERLEPFSMKPDRELRLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | BORCS5 BLOC-1 related complex subunit 5 [ Homo sapiens (human) ] |
| Official Symbol | BORCS5 |
| Synonyms | BORCS5; BLOC-1 related complex subunit 5; LOH12CR1; LOH1CR12; BLOC-1-related complex subunit 5; loss of heterozygosity 12 chromosomal region 1 protein; loss of heterozygosity, 12, chromosomal region 1; myristoylated lysosomal protein; myrlysin |
| Gene ID | 118426 |
| mRNA Refseq | NM_058169 |
| Protein Refseq | NP_477517 |
| MIM | 616598 |
| UniProt ID | Q969J3 |
| ◆ Recombinant Proteins | ||
| BORCS5-2716H | Recombinant Human BORCS5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Borcs5-1882M | Recombinant Mouse Borcs5 Protein, Myc/DDK-tagged | +Inquiry |
| BORCS5-4738H | Recombinant Human BORCS5 Protein, GST-tagged | +Inquiry |
| BORCS5-5944HF | Recombinant Full Length Human BORCS5 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BORCS5 Products
Required fields are marked with *
My Review for All BORCS5 Products
Required fields are marked with *
