Recombinant Human BPHL protein, His&Myc-tagged
Cat.No. : | BPHL-4597H |
Product Overview : | Recombinant Human BPHL protein(Q86WA6)(38-291aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 38-291aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 35.8 kDa |
AA Sequence : | SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | BPHL biphenyl hydrolase-like (serine hydrolase) [ Homo sapiens ] |
Official Symbol | BPHL |
Synonyms | BPHL; biphenyl hydrolase-like (serine hydrolase); MCNAA; valacyclovir hydrolase; Bph rp; breast epithelial mucin associated antigen; valacyclovirase; biphenyl hydrolase-like protein; biphenyl hydrolase-related protein; breast epithelial mucin-associated antigen; BPH-RP; VACVASE; MGC41865; MGC125930; |
Gene ID | 670 |
mRNA Refseq | NM_004332 |
Protein Refseq | NP_004323 |
MIM | 603156 |
UniProt ID | Q86WA6 |
◆ Recombinant Proteins | ||
BPHL-2772H | Recombinant Human BPHL Protein (38-291 aa), His-Myc-tagged | +Inquiry |
BPHL-10272H | Recombinant Human BPHL, His-tagged | +Inquiry |
BPHL-1071M | Recombinant Mouse BPHL Protein, His (Fc)-Avi-tagged | +Inquiry |
BPHL-2460M | Recombinant Mouse BPHL Protein | +Inquiry |
BPHL-3450H | Recombinant Human BPHL protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BPHL-174HCL | Recombinant Human BPHL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BPHL Products
Required fields are marked with *
My Review for All BPHL Products
Required fields are marked with *