Recombinant Human BPIFA1 protein, His-SUMO-tagged
| Cat.No. : | BPIFA1-2463H |
| Product Overview : | Recombinant Human BPIFA1 protein(Q9NP55)(20-256aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 20-256aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 40.7 kDa |
| AA Sequence : | QFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | BPIFA1 BPI fold containing family A, member 1 [ Homo sapiens ] |
| Official Symbol | BPIFA1 |
| Synonyms | BPIFA1; BPI fold containing family A, member 1; LUNX; NASG; PLUNC; SPURT; SPLUNC1; bA49G10.5; BPI fold-containing family A member 1; protein Plunc; von Ebner protein Hl; lung-specific protein X; ligand-binding protein RYA3; tracheal epithelium enriched protein; tracheal epithelium-enriched protein; nasopharyngeal carcinoma-related protein; palate, lung and nasal epithelium associated; secretory protein in upper respiratory tracts; palate lung and nasal epithelium clone protein; UNQ787/PRO1606 |
| Gene ID | 51297 |
| mRNA Refseq | NM_130852 |
| Protein Refseq | NP_057667 |
| MIM | 607412 |
| UniProt ID | Q9NP55 |
| ◆ Recombinant Proteins | ||
| BPIFA1-2787H | Recombinant Human BPIFA1 Protein, MYC/DDK-tagged | +Inquiry |
| BPIFA1-2463H | Recombinant Human BPIFA1 protein, His-SUMO-tagged | +Inquiry |
| BPIFA1-1801H | Recombinant Human BPIFA1, GST-tagged | +Inquiry |
| BPIFA1-746H | Recombinant Human BPIFA1 Protein, His/GST-tagged | +Inquiry |
| BPIFA1-1006R | Recombinant Rat BPIFA1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BPIFA1 Products
Required fields are marked with *
My Review for All BPIFA1 Products
Required fields are marked with *
