Recombinant Human Brain-derived Neurotrophic Factor, His-tagged
Cat.No. : | BDNF-231H |
Product Overview : | Recombinant Human brain-derived neurotrophic factor encoding the mature human BDNF (His129- Arg247) with 6 His tag on the N-Terminus was expressed inE. Coli.This protein was purified by Ni-NTA column. MW=16 KDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | BDNF belongs to NGF family. Monomers and homodimers bind to NTRK2/TRKB. The propeptide is N‐glycosylated and glycosulfated. The pro‐BDNF was converted into mature BDNF by plasmin. BDNF promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. It is a major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. |
Sequence : | Mature Human BDNF (His129‐Arg247)HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMG YTKEGCRGID KRHWNSQCRT TQSYVRALTM DSKKRIGWRF IRIDTSCVCT LTIKRGR. |
Purity : | > 95% in SDS-PAGE. |
Formulation : | Lyophilized 100 μg human BDNF in 50 μl of TBS ( 20 mM Tris, 50mM NaCl, pH8.0 ). Carry free (Does NOT contain BSA). |
Reconstitution : | Add 500μl deionized water or TBS to the vial to prepare a working stock solution at 200 μg/mL. Allow to set at least 30 minutes at 4℃, mix well. |
Application : | BA, ELISA. |
Storage : | Store lyophilized protein at -20℃ to-70℃. Lyophilized protein is stable for up to 6 months from date of receipt at - 20℃ to -70℃. Upon reconstitution, this protein can be stored at -20℃ for up to a few weeks or at -70℃ in a manual defrost freezer for long term storage (six months). Aliquot reconstituted protein to avoid repeated freeze / thaw cycles. |
Gene Name | BDNF brain-derived neurotrophic factor [ Homo sapiens ] |
Synonyms | BDNF;brain-derived neurotrophic factor; MGC34632; Abrineurin; neurotrophin; Brain-derived neurotrophic factor |
Gene ID | 627 |
mRNA Refseq | NM_001143805 |
Protein Refseq | NP_001137277 |
MIM | 113505 |
UniProt ID | P23560 |
Chromosome Location | 11p13 |
Pathway | Huntington"s disease; MAPK signaling pathway; Neurotrophin signaling pathway |
Function | Growth factor activity |
◆ Recombinant Proteins | ||
BDNF-08H | Recombinant Active Human BDNF Protein, His-tagged(C-ter) | +Inquiry |
BDNF-547C | Recombinant Chicken BDNF protein, His-tagged | +Inquiry |
BDNF-545D | Recombinant Dog BDNF protein, His-tagged | +Inquiry |
BDNF-553R | Recombinant Rabbit BDNF protein, His-tagged | +Inquiry |
BDNF-007H | Active Recombinant Human BDNF Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BDNF-001MCL | Recombinant Mouse BDNF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BDNF Products
Required fields are marked with *
My Review for All BDNF Products
Required fields are marked with *