Recombinant Human NPPB protein, His-tagged
| Cat.No. : | NPPB-369H |
| Product Overview : | Recombinant Human NPPB protein(101-134 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 101-134 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | PRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | NPPB natriuretic peptide B [ Homo sapiens ] |
| Official Symbol | NPPB |
| Synonyms | NPPB; natriuretic peptide B; natriuretic peptide precursor B; natriuretic peptides B; natriuretic protein; brain type natriuretic peptide; gamma-brain natriuretic peptide; BNP; |
| Gene ID | 4879 |
| mRNA Refseq | NM_002521 |
| Protein Refseq | NP_002512 |
| MIM | 600295 |
| UniProt ID | P16860 |
| ◆ Recombinant Proteins | ||
| NPPB-893H | Recombinant Human NPPB protein, His & GST-tagged | +Inquiry |
| NPPB-6643HF | Recombinant Full Length Human NPPB Protein, GST-tagged | +Inquiry |
| NPPB-31085TH | Recombinant Human NPPB protein | +Inquiry |
| NPPB-4047R | Recombinant Rat NPPB Protein | +Inquiry |
| NPPB-4734H | Recombinant Human NPPB Protein (Ser103-His134), C-Fc tagged | +Inquiry |
| ◆ Native Proteins | ||
| Nppb-5459R | Native Rat Natriuretic Peptide B | +Inquiry |
| NPPB-8052R | Native Rat Brain Natriuretic Peptide-32 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NPPB-3734HCL | Recombinant Human NPPB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPPB Products
Required fields are marked with *
My Review for All NPPB Products
Required fields are marked with *
