Recombinant Human BRSK2 protein, GST-tagged

Cat.No. : BRSK2-301152H
Product Overview : Recombinant Human BRSK2 (482-649 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met482-Leu649
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MSNLTPESSPELAKKSWFGNFISLEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGEAQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTHDPPAAQHLSEPPPPAPGLSWGAGLKGQKVATSYESSL
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name BRSK2 BR serine/threonine kinase 2 [ Homo sapiens ]
Official Symbol BRSK2
Synonyms BRSK2; BR serine/threonine kinase 2; C11orf7, chromsosome 11 open reading frame 7 , STK29; serine/threonine-protein kinase BRSK2; PEN11B; serine/threonine kinase 29; protein kinase SAD1B; brain-selective kinase 2; serine/threonine-protein kinase 29; BR serine/threonine-protein kinase 2; serine/threonine-protein kinase SAD-A; brain-specific serine/threonine-protein kinase 2; SAD1; STK29; C11orf7; FLJ41362;
Gene ID 9024
mRNA Refseq NM_001256627
Protein Refseq NP_001243556
MIM 609236
UniProt ID Q8IWQ3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BRSK2 Products

Required fields are marked with *

My Review for All BRSK2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon