Recombinant Human BRSK2 protein, GST-tagged
Cat.No. : | BRSK2-301152H |
Product Overview : | Recombinant Human BRSK2 (482-649 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met482-Leu649 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MSNLTPESSPELAKKSWFGNFISLEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGEAQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTHDPPAAQHLSEPPPPAPGLSWGAGLKGQKVATSYESSL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | BRSK2 BR serine/threonine kinase 2 [ Homo sapiens ] |
Official Symbol | BRSK2 |
Synonyms | BRSK2; BR serine/threonine kinase 2; C11orf7, chromsosome 11 open reading frame 7 , STK29; serine/threonine-protein kinase BRSK2; PEN11B; serine/threonine kinase 29; protein kinase SAD1B; brain-selective kinase 2; serine/threonine-protein kinase 29; BR serine/threonine-protein kinase 2; serine/threonine-protein kinase SAD-A; brain-specific serine/threonine-protein kinase 2; SAD1; STK29; C11orf7; FLJ41362; |
Gene ID | 9024 |
mRNA Refseq | NM_001256627 |
Protein Refseq | NP_001243556 |
MIM | 609236 |
UniProt ID | Q8IWQ3 |
◆ Recombinant Proteins | ||
BRSK2-350H | Recombinant Human BRSK2 Protein, GST-tagged | +Inquiry |
BRSK2-4834H | Recombinant Human BRSK2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Brsk2-1895M | Recombinant Mouse Brsk2 Protein, Myc/DDK-tagged | +Inquiry |
BRSK2-26106TH | Recombinant Human BRSK2, His-tagged | +Inquiry |
BRSK2-3811HF | Recombinant Full Length Human BRSK2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BRSK2-8403HCL | Recombinant Human BRSK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BRSK2 Products
Required fields are marked with *
My Review for All BRSK2 Products
Required fields are marked with *