Recombinant Human BST1 Protein, C-His-tagged
| Cat.No. : | BST1-135H |
| Product Overview : | Recombinant Human BST1 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | BST1, synthesizes the second messengers cyclic ADP-ribose and nicotinate-adenine dinucleotide phosphate, the former a second messenger that elicits calcium release from intracellular stores. May be involved in pre-B-cell growth. |
| Molecular Mass : | ~29 kDa |
| AA Sequence : | GARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKA |
| Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
| Notes : | For research use only, not for use in diagnostic procedure. |
| Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
| Concentration : | ≥0.5 mg/mL |
| Storage Buffer : | PBS, 4M Urea, pH7.4 |
| Gene Name | BST1 bone marrow stromal cell antigen 1 [ Homo sapiens (human) ] |
| Official Symbol | BST1 |
| Synonyms | BST1; bone marrow stromal cell antigen 1; ADP-ribosyl cyclase 2; ADP ribosyl cyclase 2; CD157; NAD(+) nucleosidase; BST-1; cADPr hydrolase 2; bone marrow stromal antigen 1; cyclic ADP-ribose hydrolase 2; |
| Gene ID | 683 |
| mRNA Refseq | NM_004334 |
| Protein Refseq | NP_004325 |
| MIM | 600387 |
| UniProt ID | Q10588 |
| ◆ Recombinant Proteins | ||
| BST1-1647C | Recombinant Cynomolgus BST1 protein, His-tagged | +Inquiry |
| RFL24867CF | Recombinant Full Length Candida Albicans Gpi Inositol-Deacylase(Bst1) Protein, His-Tagged | +Inquiry |
| Bst1-720M | Recombinant Mouse Bst1 Protein, MYC/DDK-tagged | +Inquiry |
| BST1-0697H | Recombinant Human BST1 Protein (Arg63-Ala313), N-His tagged | +Inquiry |
| Bst1-7108R | Recombinant Rat Bst1 protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BST1-2801HCL | Recombinant Human BST1 cell lysate | +Inquiry |
| BST1-1401RCL | Recombinant Rat BST1 cell lysate | +Inquiry |
| BST1-2620MCL | Recombinant Mouse BST1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BST1 Products
Required fields are marked with *
My Review for All BST1 Products
Required fields are marked with *
