Recombinant Human BTBD1 protein, GST-tagged
Cat.No. : | BTBD1-6785H |
Product Overview : | Recombinant Human BTBD1 protein(1-60 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-60 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MASLGPAAAGEQASGAEAEPGPAGPPPPPSPSSLGPLLPLQREPLYNWQATKASLKERFA |
Gene Name | BTBD1 BTB (POZ) domain containing 1 [ Homo sapiens ] |
Official Symbol | BTBD1 |
Synonyms | BTBD1; BTB (POZ) domain containing 1; BTB/POZ domain-containing protein 1; BTB domain containing 1; HCV NS5A-transactivated protein 8; hepatitis C virus NS5A-transactivated protein 8; C15orf1; NS5ATP8; |
Gene ID | 53339 |
mRNA Refseq | NM_001011885 |
Protein Refseq | NP_001011885 |
MIM | 608530 |
UniProt ID | Q9H0C5 |
◆ Recombinant Proteins | ||
BTBD1-6787H | Recombinant Human BTBD1 protein, His-tagged | +Inquiry |
BTBD1-366H | Recombinant Human BTBD1 Protein, GST-tagged | +Inquiry |
BTBD1-1102M | Recombinant Mouse BTBD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BTBD1-6784H | Recombinant Human BTBD1 protein, His-tagged | +Inquiry |
BTBD1-6786H | Recombinant Human BTBD1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTBD1-8400HCL | Recombinant Human BTBD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTBD1 Products
Required fields are marked with *
My Review for All BTBD1 Products
Required fields are marked with *