Recombinant Human BTBD1 protein, GST-tagged
| Cat.No. : | BTBD1-6786H |
| Product Overview : | Recombinant Human BTBD1 protein(1-256 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-256 aa |
| Tag : | N-GST |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | MASLGPAAAGEQASGAEAEPGPAGPPPPPSPSSLGPLLPLQREPLYNWQATKASLKERFAFLFNSELLSDVRFVLGKGRGAAAAGGPQRIPAHRFVLAAGSAVFDAMFNGGMATTSAEIELPDVEPAAFLALLRFLYSDEVQIGPETVMTTLYTAKKYAVPALEAHCVEFLTKHLRADNAFMLLTQARLFDEPQLASLCLDTIDKSTMDAISAEGFTDIDIDTLCAVLERDTLSIRESRLFGAVVRWAEAECQRQQ |
| Gene Name | BTBD1 BTB (POZ) domain containing 1 [ Homo sapiens ] |
| Official Symbol | BTBD1 |
| Synonyms | BTBD1; BTB (POZ) domain containing 1; BTB/POZ domain-containing protein 1; BTB domain containing 1; HCV NS5A-transactivated protein 8; hepatitis C virus NS5A-transactivated protein 8; C15orf1; NS5ATP8; |
| Gene ID | 53339 |
| mRNA Refseq | NM_001011885 |
| Protein Refseq | NP_001011885 |
| MIM | 608530 |
| UniProt ID | Q9H0C5 |
| ◆ Recombinant Proteins | ||
| BTBD1-6784H | Recombinant Human BTBD1 protein, His-tagged | +Inquiry |
| BTBD1-6785H | Recombinant Human BTBD1 protein, GST-tagged | +Inquiry |
| BTBD1-1657HF | Recombinant Full Length Human BTBD1 Protein, GST-tagged | +Inquiry |
| BTBD1-366H | Recombinant Human BTBD1 Protein, GST-tagged | +Inquiry |
| BTBD1-6786H | Recombinant Human BTBD1 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BTBD1-8400HCL | Recombinant Human BTBD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTBD1 Products
Required fields are marked with *
My Review for All BTBD1 Products
Required fields are marked with *
