Recombinant Human BTF3L4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | BTF3L4-1670H |
Product Overview : | BTF3L4 MS Standard C13 and N15-labeled recombinant protein (NP_689478) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | BTF3L4 (Basic Transcription Factor 3 Like 4) is a Protein Coding gene. An important paralog of this gene is BTF3. |
Molecular Mass : | 17.3 kDa |
AA Sequence : | MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDVPDLVENFDEASKNEANTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | BTF3L4 basic transcription factor 3-like 4 [ Homo sapiens (human) ] |
Official Symbol | BTF3L4 |
Synonyms | BTF3L4; basic transcription factor 3-like 4; transcription factor BTF3 homolog 4; MGC23908; MGC88389; |
Gene ID | 91408 |
mRNA Refseq | NM_152265 |
Protein Refseq | NP_689478 |
UniProt ID | Q96K17 |
◆ Recombinant Proteins | ||
BTF3L4-5066H | Recombinant Human BTF3L4, His-tagged | +Inquiry |
BTF3L4-465H | Recombinant Human basic transcription factor 3-like 4, His-tagged | +Inquiry |
BTF3L4-575R | Recombinant Rhesus monkey BTF3L4 Protein, His-tagged | +Inquiry |
BTF3L4-1670H | Recombinant Human BTF3L4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Btf3l4-1901M | Recombinant Mouse Btf3l4 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTF3L4-8394HCL | Recombinant Human BTF3L4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTF3L4 Products
Required fields are marked with *
My Review for All BTF3L4 Products
Required fields are marked with *