Recombinant Human BTF3L4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : BTF3L4-1670H
Product Overview : BTF3L4 MS Standard C13 and N15-labeled recombinant protein (NP_689478) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : BTF3L4 (Basic Transcription Factor 3 Like 4) is a Protein Coding gene. An important paralog of this gene is BTF3.
Molecular Mass : 17.3 kDa
AA Sequence : MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDVPDLVENFDEASKNEANTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name BTF3L4 basic transcription factor 3-like 4 [ Homo sapiens (human) ]
Official Symbol BTF3L4
Synonyms BTF3L4; basic transcription factor 3-like 4; transcription factor BTF3 homolog 4; MGC23908; MGC88389;
Gene ID 91408
mRNA Refseq NM_152265
Protein Refseq NP_689478
UniProt ID Q96K17

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BTF3L4 Products

Required fields are marked with *

My Review for All BTF3L4 Products

Required fields are marked with *

0
cart-icon
0
compare icon