Recombinant Human BTF3L4 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | BTF3L4-1670H |
| Product Overview : | BTF3L4 MS Standard C13 and N15-labeled recombinant protein (NP_689478) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | BTF3L4 (Basic Transcription Factor 3 Like 4) is a Protein Coding gene. An important paralog of this gene is BTF3. |
| Molecular Mass : | 17.3 kDa |
| AA Sequence : | MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDVPDLVENFDEASKNEANTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | BTF3L4 basic transcription factor 3-like 4 [ Homo sapiens (human) ] |
| Official Symbol | BTF3L4 |
| Synonyms | BTF3L4; basic transcription factor 3-like 4; transcription factor BTF3 homolog 4; MGC23908; MGC88389; |
| Gene ID | 91408 |
| mRNA Refseq | NM_152265 |
| Protein Refseq | NP_689478 |
| UniProt ID | Q96K17 |
| ◆ Recombinant Proteins | ||
| Btf3l4-1901M | Recombinant Mouse Btf3l4 Protein, Myc/DDK-tagged | +Inquiry |
| BTF3L4-575R | Recombinant Rhesus monkey BTF3L4 Protein, His-tagged | +Inquiry |
| BTF3L4-381H | Recombinant Human BTF3L4 Protein, GST-tagged | +Inquiry |
| BTF3L4-1670H | Recombinant Human BTF3L4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| BTF3L4-5066H | Recombinant Human BTF3L4, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BTF3L4-8394HCL | Recombinant Human BTF3L4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTF3L4 Products
Required fields are marked with *
My Review for All BTF3L4 Products
Required fields are marked with *




