Recombinant Human BTF3L4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: BTF3L4-1670H
• Product Overview: BTF3L4 MS Standard C13 and N15-labeled recombinant protein (NP_689478) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: BTF3L4 (Basic Transcription Factor 3 Like 4) is a Protein Coding gene. An important paralog of this gene is BTF3.
• Molecular Mass: 17.3 kDa
• AA Sequence: MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDVPDLVENFDEASKNEANTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: BTF3L4 basic transcription factor 3-like 4 [ Homo sapiens (human) ]
• Official Symbol: BTF3L4
• Synonyms: BTF3L4; basic transcription factor 3-like 4; transcription factor BTF3 homolog 4; MGC23908; MGC88389
• Gene ID: 91408
• mRNA Refseq: NM_152265
• Protein Refseq: NP_689478
• UniProt ID: Q96K17