Recombinant Human BTN3A2 Protein (30-248 aa), His-tagged
Cat.No. : | BTN3A2-1739H |
Product Overview : | Recombinant Human BTN3A2 Protein (30-248 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 30-248 aa |
Description : | Plays a role in T-cell responses in the adaptive immune response. Inhibits the release of IFNG from activated T-cells. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 25.6 kDa |
AA Sequence : | QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | BTN3A2 butyrophilin, subfamily 3, member A2 [ Homo sapiens ] |
Official Symbol | BTN3A2 |
Synonyms | BTN3A2; butyrophilin protein; BTF4; BT3.2; BT3.3; FLJ40011; |
Gene ID | 11118 |
mRNA Refseq | NM_001197246 |
Protein Refseq | NP_001184175 |
MIM | 613594 |
UniProt ID | P78410 |
◆ Recombinant Proteins | ||
BTN3A2-6613H | Recombinant Human BTN3A2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BTN3A2-1677HF | Recombinant Full Length Human BTN3A2 Protein, GST-tagged | +Inquiry |
BTN3A2-02H | Active Recombinant Human BTN3A2 Protein, His-Tagged | +Inquiry |
BTN3A2-6754H | Recombinant Human BTN3A2 protein, His-Avi-tagged | +Inquiry |
BTN3A2-364H | Recombinant Human BTN3A2 Protein (30-248 aa), His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTN3A2-8385HCL | Recombinant Human BTN3A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTN3A2 Products
Required fields are marked with *
My Review for All BTN3A2 Products
Required fields are marked with *