Recombinant Human BTN3A2 Protein, His-tagged

Cat.No. : BTN3A2-457H
Product Overview : Recombinant Human BTN3A2, transcript variant 1, fused with His tag at C-terminal was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : THis gene encodes a member of the immunoglobulin superfamily, which resides in the juxta-telomeric region of the major Histocompatability class 1 locus and is clustered with the other family members on chromosome 6. The encoded protein may be involved in the adaptive immune response. Alternatively spliced transcript variants encoding different isoforms have been found for tHis gene.
Form : Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH7.4
Molecular Mass : 24.6kD
AA Sequence : QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPWVDHHHHHH*
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name BTN3A2 butyrophilin, subfamily 3, member A2 [ Homo sapiens ]
Official Symbol BTN3A2
Synonyms BTN3A2; butyrophilin, subfamily 3, member A2; butyrophilin subfamily 3 member A2; butyrophilin protein; BTF4; BT3.2; BT3.3; FLJ40011;
Gene ID 11118
mRNA Refseq NM_001197246
Protein Refseq NP_001184175
MIM 613594
UniProt ID P78410

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BTN3A2 Products

Required fields are marked with *

My Review for All BTN3A2 Products

Required fields are marked with *

0
cart-icon
0
compare icon