Recombinant Human BTN3A2 Protein, His-tagged
Cat.No. : | BTN3A2-457H |
Product Overview : | Recombinant Human BTN3A2, transcript variant 1, fused with His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | THis gene encodes a member of the immunoglobulin superfamily, which resides in the juxta-telomeric region of the major Histocompatability class 1 locus and is clustered with the other family members on chromosome 6. The encoded protein may be involved in the adaptive immune response. Alternatively spliced transcript variants encoding different isoforms have been found for tHis gene. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH7.4 |
Molecular Mass : | 24.6kD |
AA Sequence : | QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPWVDHHHHHH* |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | BTN3A2 butyrophilin, subfamily 3, member A2 [ Homo sapiens ] |
Official Symbol | BTN3A2 |
Synonyms | BTN3A2; butyrophilin, subfamily 3, member A2; butyrophilin subfamily 3 member A2; butyrophilin protein; BTF4; BT3.2; BT3.3; FLJ40011; |
Gene ID | 11118 |
mRNA Refseq | NM_001197246 |
Protein Refseq | NP_001184175 |
MIM | 613594 |
UniProt ID | P78410 |
◆ Recombinant Proteins | ||
BTN3A2-395H | Recombinant Human BTN3A2 Protein, GST-tagged | +Inquiry |
BTN3A2-380HFL | Recombinant Full Length Human BTN3A2 Protein, C-Flag-tagged | +Inquiry |
BTN3A2-6613H | Recombinant Human BTN3A2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BTN3A2-459H | Recombinant Human BTN3A2 protein, His-tagged | +Inquiry |
BTN3A2-0796H | Recombinant Human BTN3A2 Protein (Gln30-Trp248), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTN3A2-8385HCL | Recombinant Human BTN3A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BTN3A2 Products
Required fields are marked with *
My Review for All BTN3A2 Products
Required fields are marked with *
0
Inquiry Basket