Recombinant Human BTNL9, His-tagged

Cat.No. : BTNL9-48H
Product Overview : Recombinant Human Butyrophilin-Like Protein 9/BTNL9 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser35-Lys256) of Human BTNL9 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 35-256 a.a.
Description : Butyrophilin-Like Protein 9 (BTNL9) is single-pass type I membrane protein member of the BTN/MOG family that belongs to the immunoglobulin superfamily. BTNL9 consists of two domains: one B30.2/SPRY domain and one Ig-like V-type (immunoglobulin-like) domain.
AA Sequence : SSEVKVLGPEYPILALVGEEVEFPCHLWPQLDAQQMEIRWFRSQTFNVVHLYQEQQELPGRQMPA FRNRTKLVKDDIAYGSVVLQLHSIIPSDKGTYGCRFHSDNFSGEALWELEVAGLGSDPHLSLEGF KEGGIQLRLRSSGWYPKPKVQWRDHQGQCLPPEFEAIVWDAQDLFSLETSVVVRAGALSNVSVSI QNLLLSQKKELVVQIADVFVPGASAWKVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Gene Name BTNL9 butyrophilin-like 9 [ Homo sapiens ]
Official Symbol BTNL9
Synonyms BTNL9; butyrophilin-like 9; butyrophilin-like protein 9; FLJ32535; butyrophilin 3; BTN3; VDLS1900;
Gene ID 153579
mRNA Refseq NM_152547
Protein Refseq NP_689760
UniProt ID Q6UXG8
Chromosome Location 5q35.3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BTNL9 Products

Required fields are marked with *

My Review for All BTNL9 Products

Required fields are marked with *

0
cart-icon