Recombinant Human BTNL9, His-tagged
| Cat.No. : | BTNL9-48H |
| Product Overview : | Recombinant Human Butyrophilin-Like Protein 9/BTNL9 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser35-Lys256) of Human BTNL9 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 35-256 a.a. |
| Description : | Butyrophilin-Like Protein 9 (BTNL9) is single-pass type I membrane protein member of the BTN/MOG family that belongs to the immunoglobulin superfamily. BTNL9 consists of two domains: one B30.2/SPRY domain and one Ig-like V-type (immunoglobulin-like) domain. |
| AA Sequence : | SSEVKVLGPEYPILALVGEEVEFPCHLWPQLDAQQMEIRWFRSQTFNVVHLYQEQQELPGRQMPA FRNRTKLVKDDIAYGSVVLQLHSIIPSDKGTYGCRFHSDNFSGEALWELEVAGLGSDPHLSLEGF KEGGIQLRLRSSGWYPKPKVQWRDHQGQCLPPEFEAIVWDAQDLFSLETSVVVRAGALSNVSVSI QNLLLSQKKELVVQIADVFVPGASAWKVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
| Gene Name | BTNL9 butyrophilin-like 9 [ Homo sapiens ] |
| Official Symbol | BTNL9 |
| Synonyms | BTNL9; butyrophilin-like 9; butyrophilin-like protein 9; FLJ32535; butyrophilin 3; BTN3; VDLS1900; |
| Gene ID | 153579 |
| mRNA Refseq | NM_152547 |
| Protein Refseq | NP_689760 |
| UniProt ID | Q6UXG8 |
| Chromosome Location | 5q35.3 |
| ◆ Recombinant Proteins | ||
| BTNL9-612H | Recombinant Human BTNL9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| BTNL9-2544M | Recombinant Mouse BTNL9 Protein | +Inquiry |
| BTNL9-001M | Active Recombinant Mouse Btnl9 Protein, Fc-tagged | +Inquiry |
| BTNL9-48H | Recombinant Human BTNL9, His-tagged | +Inquiry |
| BTNL9-49H | Recombinant Human BTNL9 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTNL9 Products
Required fields are marked with *
My Review for All BTNL9 Products
Required fields are marked with *
