Recombinant Human C10orf91 Protein, GST-tagged

Cat.No. : C10orf91-451H
Product Overview : Human C10orf91 full-length ORF (NP_775812.1, 1 a.a. - 145 a.a.) recombinant protein with GST tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 41.8 kDa
AA Sequence : MWSFLPGAESVSMGPVPGVSSLGACWTHDQDSGRAEDRPQAPRITQYTWVLSFLFTEKPQTRSTSPISHQGQPQTTRALSLRQPQHPSAPASGRPRPPHSSGPDLAEAAPVVDQASQAAGRASSGLGLWEQASVSQGFRNAAFEA
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C10orf91 chromosome 10 open reading frame 91 [ Homo sapiens ]
Official Symbol C10orf91
Synonyms bA432J24.4; RP11-432J24.4
Gene ID 170393
mRNA Refseq NM_173541.2
Protein Refseq NP_775812.1
UniProt ID Q5T1B1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C10orf91 Products

Required fields are marked with *

My Review for All C10orf91 Products

Required fields are marked with *

0
cart-icon
0
compare icon