Recombinant Human C10orf91 Protein, GST-tagged

• Cat.No.: C10orf91-451H
• Product Overview: Human C10orf91 full-length ORF (NP_775812.1, 1 a.a. - 145 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 41.8 kDa
• AA Sequence: MWSFLPGAESVSMGPVPGVSSLGACWTHDQDSGRAEDRPQAPRITQYTWVLSFLFTEKPQTRSTSPISHQGQPQTTRALSLRQPQHPSAPASGRPRPPHSSGPDLAEAAPVVDQASQAAGRASSGLGLWEQASVSQGFRNAAFEA
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C10orf91 chromosome 10 open reading frame 91 [ Homo sapiens ]
• Official Symbol: C10orf91
• Synonyms: bA432J24.4; RP11-432J24.4
• Gene ID: 170393
• mRNA Refseq: NM_173541.2
• Protein Refseq: NP_775812.1
• UniProt ID: Q5T1B1