Recombinant Human C10orf91 Protein, GST-tagged
Cat.No. : | C10orf91-451H |
Product Overview : | Human C10orf91 full-length ORF (NP_775812.1, 1 a.a. - 145 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 41.8 kDa |
AA Sequence : | MWSFLPGAESVSMGPVPGVSSLGACWTHDQDSGRAEDRPQAPRITQYTWVLSFLFTEKPQTRSTSPISHQGQPQTTRALSLRQPQHPSAPASGRPRPPHSSGPDLAEAAPVVDQASQAAGRASSGLGLWEQASVSQGFRNAAFEA |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C10orf91 chromosome 10 open reading frame 91 [ Homo sapiens ] |
Official Symbol | C10orf91 |
Synonyms | bA432J24.4; RP11-432J24.4 |
Gene ID | 170393 |
mRNA Refseq | NM_173541.2 |
Protein Refseq | NP_775812.1 |
UniProt ID | Q5T1B1 |
◆ Recombinant Proteins | ||
C10orf91-451H | Recombinant Human C10orf91 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C10orf91-72HCL | Recombinant Human C10orf91 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C10orf91 Products
Required fields are marked with *
My Review for All C10orf91 Products
Required fields are marked with *