Recombinant Human C11orf65 Protein, GST-tagged
Cat.No. : | C11orf65-479H |
Product Overview : | Human C11orf65 full-length ORF ( AAH59411.1, 1 a.a. - 313 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 63 kDa |
AA Sequence : | MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQIVKYINPKEAELLDAAAGIHVRFRLGGVKFPPDIYYKIFTHRPIEDLCANSPRNYAKLPAKHTSHNKNDHLQEEDHSGWYHRIENNGWRPVSDTFWLSTDGMVVEDKKESEFHFSKLKRRQDLEKKRKLRKIELMRQMYYSGSLEAKSTHHETLGLIHTATKGLIRAFEDGGIDSVMEWEVDEVLNWTNTLNLDEYIASWKEIATSNSSANFKGFRFNQAQKNIYNYGGDISKMQMGIPDDTYYENVYQEPNVTRLTPDSTYGL |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C11orf65 chromosome 11 open reading frame 65 [ Homo sapiens ] |
Official Symbol | C11orf65 |
Synonyms | C11ORF65; chromosome 11 open reading frame 65; uncharacterized protein C11orf65; MGC33948; |
Gene ID | 160140 |
mRNA Refseq | NM_152587 |
Protein Refseq | NP_689800 |
UniProt ID | Q8NCR3 |
◆ Recombinant Proteins | ||
C11orf65-1845HF | Recombinant Full Length Human C11orf65 Protein, GST-tagged | +Inquiry |
C11orf65-479H | Recombinant Human C11orf65 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C11orf65-76HCL | Recombinant Human C11orf65 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C11orf65 Products
Required fields are marked with *
My Review for All C11orf65 Products
Required fields are marked with *