Recombinant Human C1QA protein, His&Myc-tagged
| Cat.No. : | C1QA-2203H |
| Product Overview : | Recombinant Human C1QA protein(P02745)(23-245aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | His&Myc |
| Protein Length : | 23-245aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 27.7 kDa |
| AA Sequence : | EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | C1QA complement component 1, q subcomponent, A chain [ Homo sapiens ] |
| Official Symbol | C1QA |
| Synonyms | C1QA; complement component 1, q subcomponent, A chain; complement component 1, q subcomponent, alpha polypeptide; complement C1q subcomponent subunit A; complement component C1q, A chain; |
| Gene ID | 712 |
| mRNA Refseq | NM_015991 |
| Protein Refseq | NP_057075 |
| MIM | 120550 |
| UniProt ID | P02745 |
| ◆ Recombinant Proteins | ||
| C1qa-2608M | Recombinant Mouse C1qa protein, His-SUMO-tagged | +Inquiry |
| C1QA-2607H | Recombinant Human C1QA protein, His&Myc-tagged | +Inquiry |
| C1qa-7932M | Recombinant Mouse C1qa protein, His & T7-tagged | +Inquiry |
| C1QA-2528H | Recombinant Human C1QA protein(23-245 aa), C-His-tagged | +Inquiry |
| C1QA-2722Z | Recombinant Zebrafish C1QA | +Inquiry |
| ◆ Native Proteins | ||
| C1QA-26126TH | Native Human C1QA | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C1QA-8143HCL | Recombinant Human C1QA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C1QA Products
Required fields are marked with *
My Review for All C1QA Products
Required fields are marked with *
