Recombinant Human C1QC protein, His-GST-tagged
Cat.No. : | C1QC-143H |
Product Overview : | Recombinant Human ADAM10 protein(Q13428)(Gln1251-Lys1480), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Gln1251-Lys1480 |
Tag : | C-His |
Form : | Phosphate buffered saline |
Molecular Mass : | 27 kDa |
Storage : | Store at -20°C to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | QAAGMLSPKTGGKEAASGTTPQKSRKPKKGAGNPQASTLALQSNITQCLLGQPWPLNEAQVQASVVKVLTELLEQERKKVVDTTKESSRKGWESRKRKLSGDQPAARTPRSKKKKKLGAGEGGEASVSPEKTSTTSKGKAKRDKASGDVKEKKGKGSLGSQGAKDEPEEELQKGMGTVEGGDQSNPKSKKEKKKSDKRKKDKEKKEKKKKAKKASTKDSESPSQKKKKKK |
Gene Name | ADAM10 ADAM metallopeptidase domain 10 [ Homo sapiens ] |
Official Symbol | ADAM10 |
Synonyms | ADAM10; ADAM metallopeptidase domain 10; a disintegrin and metalloproteinase domain 10; disintegrin and metalloproteinase domain-containing protein 10; CD156c; HsT18717; kuz; MADM; CDw156; ADAM 10; kuzbanian protein homolog; mammalian disintegrin-metalloprotease; a disintegrin and metalloprotease domain 10; AD10; |
Gene ID | 102 |
mRNA Refseq | NM_001110 |
Protein Refseq | NP_001101 |
MIM | 602192 |
UniProt ID | O14672 |
◆ Recombinant Proteins | ||
C1QC-586R | Recombinant Rhesus monkey C1QC Protein, His-tagged | +Inquiry |
C1QC-334H | Recombinant Human C1QC Protein, His-tagged | +Inquiry |
C1QC-1044R | Recombinant Rat C1QC Protein | +Inquiry |
C1QC-702R | Recombinant Rat C1QC Protein, His (Fc)-Avi-tagged | +Inquiry |
C1qc-336R | Recombinant Rat C1qc Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1QC-8142HCL | Recombinant Human C1QC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C1QC Products
Required fields are marked with *
My Review for All C1QC Products
Required fields are marked with *
0
Inquiry Basket