Recombinant Human C1QC protein, His-GST-tagged
| Cat.No. : | C1QC-143H |
| Product Overview : | Recombinant Human ADAM10 protein(Q13428)(Gln1251-Lys1480), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Gln1251-Lys1480 |
| Tag : | C-His |
| Form : | Phosphate buffered saline |
| Molecular Mass : | 27 kDa |
| Storage : | Store at -20°C to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | QAAGMLSPKTGGKEAASGTTPQKSRKPKKGAGNPQASTLALQSNITQCLLGQPWPLNEAQVQASVVKVLTELLEQERKKVVDTTKESSRKGWESRKRKLSGDQPAARTPRSKKKKKLGAGEGGEASVSPEKTSTTSKGKAKRDKASGDVKEKKGKGSLGSQGAKDEPEEELQKGMGTVEGGDQSNPKSKKEKKKSDKRKKDKEKKEKKKKAKKASTKDSESPSQKKKKKK |
| Gene Name | ADAM10 ADAM metallopeptidase domain 10 [ Homo sapiens ] |
| Official Symbol | ADAM10 |
| Synonyms | ADAM10; ADAM metallopeptidase domain 10; a disintegrin and metalloproteinase domain 10; disintegrin and metalloproteinase domain-containing protein 10; CD156c; HsT18717; kuz; MADM; CDw156; ADAM 10; kuzbanian protein homolog; mammalian disintegrin-metalloprotease; a disintegrin and metalloprotease domain 10; AD10; |
| Gene ID | 102 |
| mRNA Refseq | NM_001110 |
| Protein Refseq | NP_001101 |
| MIM | 602192 |
| UniProt ID | O14672 |
| ◆ Recombinant Proteins | ||
| C1QC-5655H | Recombinant Human C1QC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| C1QC-8142H | Recombinant Human C1QC, MYC/DDK-tagged | +Inquiry |
| C1qc-731M | Recombinant Mouse C1qc Protein, MYC/DDK-tagged | +Inquiry |
| C1QC-1279HFL | Recombinant Full Length Human C1QC, Flag-tagged | +Inquiry |
| C1QC-2563M | Recombinant Mouse C1QC Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C1QC-8142HCL | Recombinant Human C1QC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C1QC Products
Required fields are marked with *
My Review for All C1QC Products
Required fields are marked with *
