Recombinant Human C1QC Protein, His tagged

• Cat.No.: C1QC-926H
• Product Overview: Recombinant Human C1QC Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 29-245 aa
• Description: This gene encodes the C-chain polypeptide of serum complement subcomponent C1q, which associates with C1r and C1s to yield the first component of the serum complement system. C1q is composed of 18 polypeptide chains which include 6 A-chains, 6 B-chains, and 6 C-chains. Each chain contains an N-terminal collagen-like region and a C-terminal C1q globular domain. C1q deficiency is associated with lupus erythematosus and glomerulonephritis.
• Form: Sterile PBS, 0.5% SKL
• Molecular Mass: 25 kDa
• AASequence: MGSSHHHHHHSSGLVPRGSHMNTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD
• Endotoxin: < 1.0 EU/μg of the protein by the LAL method.
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: C1QC complement component 1, q subcomponent, C chain [ Homo sapiens (human) ]
• Official Symbol: C1QC
• Synonyms: C1QC; complement component 1, q subcomponent, C chain; C1QG, complement component 1, q subcomponent, gamma polypeptide; complement C1q subcomponent subunit C; complement component 1, q subcomponent, gamma polypeptide; C1QG; C1Q-C; FLJ27103
• Gene ID: 714
• mRNA Refseq: NM_001114101
• Protein Refseq: NP_001107573
• MIM: 120575
• UniProt ID: P02747