"C1QTNF9" Related Products

Expand

Recombinant Human C1QTNF9 protein, His-tagged

Cat.No.: C1QTNF9-19H
Product Overview: Recombinant Human C1QTNF9(Gln20-Pro333) fused with His tag at C-terminal was expressed in HEK293.
Description: Complement C1q and tumor necrosis factor-related protein 9A is also known as C1QTNF9A, AQL1, CTRP9, C1q and tumor necrosis factor related protein 9. C1QTNF9 is a secreted protein and contains one C1q domain and three collagen-like domains. C1QTNF9 interacts with ADIPOQ via the C1q domain to form a heterotrimeric complex and also interacts with CTRP9B to forms heterotrimers and heterooligomeric complexes with CTRP9B. C1QTNF9 is expressed predominantly in adipose tissue. C1QTNF9 can activates AMPK, AKT, and p44/42 MAPK signaling pathways.
Source: HEK293
Species: Human
Tag: His
Form: Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4
AA Sequence: QDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGRPGSPGKDGTSGEKGERGADGKVEA KGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETGPQGQKGNKGDVGPTGPEGPRGNIGPLGPTG LPGPMGPIGKPGPKGEAGPTGPQGEPGVRGIRGWKGDRGEKGKIGETLVLPKSAFTVGLTVLSKF PSSDVPIKFDKILYNEFNHYDTAAGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTKDA YMSSEDQASGGIVLQLKLGDEVWLQVTGGERFNGLFADEDDDTTFTGFLLFSSPVDHHHHHH
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name: C1QTNF9 C1q and tumor necrosis factor related protein 9 [ Homo sapiens ]
Official Symbol: C1QTNF9
Synonyms: C1QTNF9; C1q and tumor necrosis factor related protein 9; complement C1q and tumor necrosis factor-related protein 9A; AQL1; C1QTNF9A; CTRP9; MGC48915; complement C1q tumor necrosis factor-related protein 9; complement C1q tumor necrosis factor-related protein 9A; complement C1q and tumor necrosis factor-related protein 9;
Gene ID: 338872
mRNA Refseq: NM_178540
Protein Refseq: NP_848635
MIM: 614285
UniProt ID: P0C862
Chromosome Location: 13q12.12
Function: hormone activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.