Recombinant Human C1QTNF9 protein, His-tagged

• Cat.No.: C1QTNF9-19H
• Product Overview: Recombinant Human C1QTNF9(Gln20-Pro333) fused with His tag at C-terminal was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 20-333 a.a.
• Description: Complement C1q and tumor necrosis factor-related protein 9A is also known as C1QTNF9A, AQL1, CTRP9, C1q and tumor necrosis factor related protein 9. C1QTNF9 is a secreted protein and contains one C1q domain and three collagen-like domains. C1QTNF9 interacts with ADIPOQ via the C1q domain to form a heterotrimeric complex and also interacts with CTRP9B to forms heterotrimers and heterooligomeric complexes with CTRP9B. C1QTNF9 is expressed predominantly in adipose tissue. C1QTNF9 can activates AMPK, AKT, and p44/42 MAPK signaling pathways.
• Form: Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4
• AA Sequence: QDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGRPGSPGKDGTSGEKGERGADGKVEA KGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETGPQGQKGNKGDVGPTGPEGPRGNIGPLGPTG LPGPMGPIGKPGPKGEAGPTGPQGEPGVRGIRGWKGDRGEKGKIGETLVLPKSAFTVGLTVLSKF PSSDVPIKFDKILYNEFNHYDTAAGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTKDA YMSSEDQASGGIVLQLKLGDEVWLQVTGGERFNGLFADEDDDTTFTGFLLFSSPVDHHHHHH
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at < -20°C for 3 months.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: C1QTNF9 C1q and tumor necrosis factor related protein 9 [ Homo sapiens ]
• Official Symbol: C1QTNF9
• Synonyms: C1QTNF9; C1q and tumor necrosis factor related protein 9; complement C1q and tumor necrosis factor-related protein 9A; AQL1; C1QTNF9A; CTRP9; MGC48915; complement C1q tumor necrosis factor-related protein 9; complement C1q tumor necrosis factor-related protein 9A; complement C1q and tumor necrosis factor-related protein 9
• Gene ID: 338872
• mRNA Refseq: NM_178540
• Protein Refseq: NP_848635
• MIM: 614285
• UniProt ID: P0C862
• Chromosome Location: 13q12.12
• Function: hormone activity