Recombinant Human C1QTNF9 protein, His-tagged

Cat.No. : C1QTNF9-19H
Product Overview : Recombinant Human C1QTNF9(Gln20-Pro333) fused with His tag at C-terminal was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 20-333 a.a.
Description : Complement C1q and tumor necrosis factor-related protein 9A is also known as C1QTNF9A, AQL1, CTRP9, C1q and tumor necrosis factor related protein 9. C1QTNF9 is a secreted protein and contains one C1q domain and three collagen-like domains. C1QTNF9 interacts with ADIPOQ via the C1q domain to form a heterotrimeric complex and also interacts with CTRP9B to forms heterotrimers and heterooligomeric complexes with CTRP9B. C1QTNF9 is expressed predominantly in adipose tissue. C1QTNF9 can activates AMPK, AKT, and p44/42 MAPK signaling pathways.
Form : Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4
AA Sequence : QDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGRPGSPGKDGTSGEKGERGADGKVEA KGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETGPQGQKGNKGDVGPTGPEGPRGNIGPLGPTG LPGPMGPIGKPGPKGEAGPTGPQGEPGVRGIRGWKGDRGEKGKIGETLVLPKSAFTVGLTVLSKF PSSDVPIKFDKILYNEFNHYDTAAGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTKDA YMSSEDQASGGIVLQLKLGDEVWLQVTGGERFNGLFADEDDDTTFTGFLLFSSPVDHHHHHH
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name C1QTNF9 C1q and tumor necrosis factor related protein 9 [ Homo sapiens ]
Official Symbol C1QTNF9
Synonyms C1QTNF9; C1q and tumor necrosis factor related protein 9; complement C1q and tumor necrosis factor-related protein 9A; AQL1; C1QTNF9A; CTRP9; MGC48915; complement C1q tumor necrosis factor-related protein 9; complement C1q tumor necrosis factor-related protein 9A; complement C1q and tumor necrosis factor-related protein 9;
Gene ID 338872
mRNA Refseq NM_178540
Protein Refseq NP_848635
MIM 614285
UniProt ID P0C862
Chromosome Location 13q12.12
Function hormone activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C1QTNF9 Products

Required fields are marked with *

My Review for All C1QTNF9 Products

Required fields are marked with *

0
cart-icon