"C21orf33" Related Products

Recombinant Human C21orf33 protein, GST-tagged

Cat.No.: C21orf33-21H
Product Overview: Recombinant Human C21orf33(188 a.a. - 268 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: This gene encodes a potential mitochondrial protein that is a member of the DJ-1/PfpI gene family. This protein is overexpressed in fetal Down syndrome brain. Alternate splicing results in multiple transcript variants.
Source: Wheat Germ
Species: Human
Tag : GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 34.65 kDa
Protein length: 188 a.a. - 268 a.a.
AA Sequence: RGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: C21orf33 chromosome 21 open reading frame 33 [ Homo sapiens ]
Official Symbol: C21orf33
Synonyms: C21ORF33; chromosome 21 open reading frame 33; ES1 protein homolog, mitochondrial; D21S2048E; ES1; GT335; HES1; KNP I; KNP Ia; KNPH; KNPI; Keio novel protein I; human HES1 protein, homolog to E.coli and zebrafish ES1 protein;
Gene ID: 8209
mRNA Refseq: NM_004649
Protein Refseq: NP_004640
MIM: 601659
UniProt ID: P30042
Chromosome Location: 21q22.3

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.