Recombinant Human C21orf33 protein, GST-tagged
Cat.No. : | C21orf33-21H |
Product Overview : | Recombinant Human C21orf33(188 a.a. - 268 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 188 a.a. - 268 a.a. |
Description : | This gene encodes a potential mitochondrial protein that is a member of the DJ-1/PfpI gene family. This protein is overexpressed in fetal Down syndrome brain. Alternate splicing results in multiple transcript variants. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 34.65 kDa |
AA Sequence : | RGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | C21orf33 chromosome 21 open reading frame 33 [ Homo sapiens ] |
Official Symbol | C21orf33 |
Synonyms | C21ORF33; chromosome 21 open reading frame 33; ES1 protein homolog, mitochondrial; D21S2048E; ES1; GT335; HES1; KNP I; KNP Ia; KNPH; KNPI; Keio novel protein I; human HES1 protein, homolog to E.coli and zebrafish ES1 protein; |
Gene ID | 8209 |
mRNA Refseq | NM_004649 |
Protein Refseq | NP_004640 |
MIM | 601659 |
UniProt ID | P30042 |
Chromosome Location | 21q22.3 |
◆ Recombinant Proteins | ||
C21orf33-21H | Recombinant Human C21orf33 protein, GST-tagged | +Inquiry |
C21orf33-20H | Recombinant Human C21orf33 protein, GST-tagged | +Inquiry |
C21orf33-713HF | Recombinant Full Length Human C21orf33 Protein, GST-tagged | +Inquiry |
C21ORF33-1185H | Recombinant Human C21ORF33 Protein (43-268 aa), GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C21orf33-8103HCL | Recombinant Human C21orf33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C21orf33 Products
Required fields are marked with *
My Review for All C21orf33 Products
Required fields are marked with *