Recombinant Human C2orf88 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | C2orf88-837H |
| Product Overview : | C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_001035986) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Binds to type I regulatory subunits of protein kinase A (PKA-RI) and may anchor/target them to the plasma membrane. |
| Molecular Mass : | 11 kDa |
| AA Sequence : | MGCMKSKQTFPFPTIYEGEKQHESEEPFMPEERCLPRMASPVNVKEEVKEPPGTNIVILEYAHRLSQDILCDALQQWACNNIKYHDIPYIESEGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | C2orf88 chromosome 2 open reading frame 88 [ Homo sapiens (human) ] |
| Official Symbol | C2orf88 |
| Synonyms | C2orf88; chromosome 2 open reading frame 88; small membrane A-kinase anchor protein; small A-kinase anchoring protein; small membrane AKAP |
| Gene ID | 84281 |
| mRNA Refseq | NM_001042521 |
| Protein Refseq | NP_001035986 |
| MIM | 615117 |
| UniProt ID | Q9BSF0 |
| ◆ Recombinant Proteins | ||
| C2orf88-4889H | Recombinant Human C2orf88 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| C2orf88-837H | Recombinant Human C2orf88 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| C2orf88-6551H | Recombinant Human C2orf88 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C2orf88-8057HCL | Recombinant Human C2orf88 293 Cell Lysate | +Inquiry |
| C2orf88-8058HCL | Recombinant Human C2orf88 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C2orf88 Products
Required fields are marked with *
My Review for All C2orf88 Products
Required fields are marked with *
