Recombinant Human C4A protein, His-tagged
Cat.No. : | C4A-3784H |
Product Overview : | Recombinant Human C4A protein(1017-1336 aa), fused to His tag, was expressed in E. coli. |
Availability | June 17, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1017-1336 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | YLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEIASAGLLGAHAAAITAYALTLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTQAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQAAAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGR |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | C4A complement component 4A (Rodgers blood group) [ Homo sapiens ] |
Official Symbol | C4A |
Synonyms | C4A; complement component 4A (Rodgers blood group); complement component 4A; complement C4-A; C4; C4A2; C4A3; C4A4; C4A6; C4B; C4S; CO4; CPAMD2; RG; acidic C4; C4A anaphylatoxin; Rodgers form of C4; acidic complement C4; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2; C4AD; MGC164979; |
Gene ID | 720 |
mRNA Refseq | NM_001252204 |
Protein Refseq | NP_001239133 |
MIM | 120810 |
UniProt ID | P0C0L4 |
◆ Recombinant Proteins | ||
C4A-188H | Recombinant Human C4A protein, T7/His-tagged | +Inquiry |
C4a-339R | Recombinant Rat C4a Protein, His-tagged | +Inquiry |
C4A-1052R | Recombinant Rat C4A Protein | +Inquiry |
C4A-566H | Recombinant Human C4A Protein, His/GST-tagged | +Inquiry |
C4A-0050H | Recombinant Human C4A Protein, GST-Tagged | +Inquiry |
◆ Native Proteins | ||
C4A-158H | Native Human C4A protein | +Inquiry |
C4A-8392H | Native Human C4A | +Inquiry |
C4A-2H | Native Human Complement C4 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C4A Products
Required fields are marked with *
My Review for All C4A Products
Required fields are marked with *
0
Inquiry Basket