Recombinant Human C4A protein, His-tagged
| Cat.No. : | C4A-3784H |
| Product Overview : | Recombinant Human C4A protein(1017-1336 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 17, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1017-1336 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | YLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEIASAGLLGAHAAAITAYALTLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTQAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQAAAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGR |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | C4A complement component 4A (Rodgers blood group) [ Homo sapiens ] |
| Official Symbol | C4A |
| Synonyms | C4A; complement component 4A (Rodgers blood group); complement component 4A; complement C4-A; C4; C4A2; C4A3; C4A4; C4A6; C4B; C4S; CO4; CPAMD2; RG; acidic C4; C4A anaphylatoxin; Rodgers form of C4; acidic complement C4; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2; C4AD; MGC164979; |
| Gene ID | 720 |
| mRNA Refseq | NM_001252204 |
| Protein Refseq | NP_001239133 |
| MIM | 120810 |
| UniProt ID | P0C0L4 |
| ◆ Recombinant Proteins | ||
| C4a-339R | Recombinant Rat C4a Protein, His-tagged | +Inquiry |
| C4A-0345H | Recombinant Human C4A Protein (Asn680-Arg756), N-His-tagged | +Inquiry |
| C4A-566H | Active Recombinant Human C4A protein, His-GST-tagged | +Inquiry |
| C4A-187H | Recombinant Human C4A protein, T7/His-tagged | +Inquiry |
| C4A-710R | Recombinant Rat C4A Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Native Proteins | ||
| C4A-2H | Native Human Complement C4 | +Inquiry |
| C4A-8392H | Native Human C4A | +Inquiry |
| C4A-158H | Native Human C4A protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C4A Products
Required fields are marked with *
My Review for All C4A Products
Required fields are marked with *
