Recombinant Human C4A protein, T7/His-tagged

Cat.No. : C4A-187H
Product Overview : Recombinant human C4a domain cDNA (756 – 757 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPA FLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIAR RHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSGGSHHHHHHGSENLYFQGFNVNFQKA INEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCWEPFLSCCQFAESLRKKSRDKGQAGLQ
Purity : >90% by SDS-PAGE.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name C4A complement component 4A (Rodgers blood group) [ Homo sapiens ]
Official Symbol C4A
Synonyms C4A; complement C4-A; C4; C4A2; C4A3; C4A4; C4A6; C4B; C4S; CO4; CPAMD2; RG; acidic C4; C4A anaphylatoxin; Rodgers form of C4; acidic complement C4
Gene ID 720
mRNA Refseq NM_001252204
Protein Refseq NP_001239133
MIM 120810
UniProt ID P0C0L4
Chromosome Location 6p21.3
Pathway Activation of C3 and C5, organism-specific biosystem; Complement Activation, Classical Pathway, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Complement cascade, organism-specific biosystem; Immune System, organism-specific biosystem; Initial triggering of complement, organism-specific biosystem;
Function endopeptidase inhibitor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C4A Products

Required fields are marked with *

My Review for All C4A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon