Recombinant Human C4A protein, T7/His-tagged
| Cat.No. : | C4A-187H |
| Product Overview : | Recombinant human C4a domain cDNA (756 – 757 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPA FLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIAR RHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSGGSHHHHHHGSENLYFQGFNVNFQKA INEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCWEPFLSCCQFAESLRKKSRDKGQAGLQ |
| Purity : | >90% by SDS-PAGE. |
| Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Gene Name | C4A complement component 4A (Rodgers blood group) [ Homo sapiens ] |
| Official Symbol | C4A |
| Synonyms | C4A; complement C4-A; C4; C4A2; C4A3; C4A4; C4A6; C4B; C4S; CO4; CPAMD2; RG; acidic C4; C4A anaphylatoxin; Rodgers form of C4; acidic complement C4 |
| Gene ID | 720 |
| mRNA Refseq | NM_001252204 |
| Protein Refseq | NP_001239133 |
| MIM | 120810 |
| UniProt ID | P0C0L4 |
| Chromosome Location | 6p21.3 |
| Pathway | Activation of C3 and C5, organism-specific biosystem; Complement Activation, Classical Pathway, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Complement cascade, organism-specific biosystem; Immune System, organism-specific biosystem; Initial triggering of complement, organism-specific biosystem; |
| Function | endopeptidase inhibitor activity; |
| ◆ Recombinant Proteins | ||
| C4A-187H | Recombinant Human C4A protein, T7/His-tagged | +Inquiry |
| C4A-31H | Recombinant Human C4A Protein (957-1336), N-T7-His-TEV tagged | +Inquiry |
| C4A-0346H | Recombinant Human C4A Protein (Thr1021-Thr1330), N-His-tagged | +Inquiry |
| C4a-339R | Recombinant Rat C4a Protein, His-tagged | +Inquiry |
| C4A-98H | Recombinant Human C4A protein, T7/His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| C4A-158H | Native Human C4A protein | +Inquiry |
| C4A-8392H | Native Human C4A | +Inquiry |
| C4A-2H | Native Human Complement C4 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C4A Products
Required fields are marked with *
My Review for All C4A Products
Required fields are marked with *



