Recombinant Human C4ORF3 Protein (1-44 aa), His-SUMO-tagged
Cat.No. : | C4ORF3-1071H |
Product Overview : | Recombinant Human C4ORF3 Protein (1-44 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-44 aa |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 20.8 kDa |
AA Sequence : | MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKHSY |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | C4orf3 chromosome 4 open reading frame 3 [ Homo sapiens ] |
Official Symbol | C4ORF3 |
Gene ID | 401152 |
mRNA Refseq | NM_001170330.1 |
Protein Refseq | NP_001163801.1 |
UniProt ID | Q8WVX3 |
◆ Recombinant Proteins | ||
C4ORF3-1071H | Recombinant Human C4ORF3 Protein (1-44 aa), His-SUMO-tagged | +Inquiry |
RFL21474HF | Recombinant Full Length Human Uncharacterized Protein C4Orf3(C4Orf3) Protein, His-Tagged | +Inquiry |
C4orf3-129H | Recombinant Human C4orf3 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
C4orf3-1869H | Recombinant Human C4orf3 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C4ORF3 Products
Required fields are marked with *
My Review for All C4ORF3 Products
Required fields are marked with *
0
Inquiry Basket