Recombinant Human C5orf60 Protein

Cat.No. : C5orf60-5247H
Product Overview : Human C5orf60 full-length ORF (ADR83448.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : C5orf60 (Chromosome 5 Open Reading Frame 60) is a Protein Coding gene.
Form : Liquid
Molecular Mass : 11.5 kDa
AA Sequence : MPSSVPKTSVESLGSPSSLSSSKPREPLCPLKHPSHQPPASTLSPNPTSSTESLGETPHAGRWRQGSRFPQPGCANAAGRIRHQNPRHSHGHRISDIHEQLGIS
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name C5orf60 chromosome 5 open reading frame 60 [ Homo sapiens (human) ]
Official Symbol C5orf60
Synonyms LOC285679; C5orf60; chromosome 5 open reading frame 60; putative uncharacterized protein FLJ35723
Gene ID 285679
mRNA Refseq NM_001142306
Protein Refseq NP_001135778
UniProt ID A6NFR6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C5orf60 Products

Required fields are marked with *

My Review for All C5orf60 Products

Required fields are marked with *

0
cart-icon
0
compare icon