Recombinant Human C7 protein, His-tagged
Cat.No. : | C7-2439H |
Product Overview : | Recombinant Human C7 protein(310-690 aa), fused to His tag, was expressed in E. coli. |
Availability | June 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 310-690 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GGEYRVLFYVDSEKLKQNDFNSVEEKKCKSSGWHFVVKFSSHGCKELENALKAASGTQNNVLRGEPFIRGGGAGFISGLSYLELDNPAGNKRRYSAWAESVTNLPQVIKQKLTPLYELVKEVPCASVKKLYLKWALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPYTFGAACEQGVLVGNQAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCVGETTESTQCEDEELEHLRLLEPHCFPLSLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCNEGYSLIGNPVARCGEDLRWLVGEMHCQKIACVLPVLMDGIQSHPQKPFYTVGEKVTVSCSGGMSLEGPSAFLCGSSLKWSPEMKNARCVQ |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | C7 complement component 7 [ Homo sapiens ] |
Official Symbol | C7 |
Synonyms | C7; complement component 7; complement component C7; |
Gene ID | 730 |
mRNA Refseq | NM_000587 |
Protein Refseq | NP_000578 |
MIM | 217070 |
UniProt ID | P10643 |
◆ Recombinant Proteins | ||
C7-823P | Recombinant Pig C7 protein, His & GST-tagged | +Inquiry |
C7-7369H | Recombinant Human C7 protein(Met1-Gln843), His-tagged | +Inquiry |
C7-0129H | Recombinant Human C7 Protein, GST-Tagged | +Inquiry |
C7-0585H | Recombinant Human C7 Protein (Ser122-His456), His-tagged | +Inquiry |
C7-2715HF | Recombinant Full Length Human C7 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
C7-102H | Active Native Human C7 Protein | +Inquiry |
C7-56H | Native Human Complement C7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
C7-1500HCL | Recombinant Human C7 cell lysate | +Inquiry |
C7-1425HCL | Recombinant Human C7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C7 Products
Required fields are marked with *
My Review for All C7 Products
Required fields are marked with *