Recombinant Human C8G Protein, His-tagged

Cat.No. : C8G-2788H
Product Overview : Recombinant Human C8G Protein is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Form : Tris-based buffer,50% glycerol
Molecular Mass : 22.9 kDa
AA Sequence : QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Full Length : Full L.
Gene Name C8G complement component 8, gamma polypeptide [ Homo sapiens ]
Official Symbol C8G
Synonyms C8G; complement component 8, gamma polypeptide; complement component C8 gamma chain; C8C; MGC142186;
Gene ID 733
mRNA Refseq NM_000606
Protein Refseq NP_000597
MIM 120930
UniProt ID P07360

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C8G Products

Required fields are marked with *

My Review for All C8G Products

Required fields are marked with *

0

Inquiry Basket

cartIcon