Recombinant Human C8G Protein, His-tagged

• Cat.No.: C8G-2788H
• Product Overview: Recombinant Human C8G Protein is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 22.9 kDa
• AA Sequence: QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
• Full Length: Full L.

Gene Information

• Gene Name: C8G complement component 8, gamma polypeptide [ Homo sapiens ]
• Official Symbol: C8G
• Synonyms: C8G; complement component 8, gamma polypeptide; complement component C8 gamma chain; C8C; MGC142186
• Gene ID: 733
• mRNA Refseq: NM_000606
• Protein Refseq: NP_000597
• MIM: 120930
• UniProt ID: P07360