Recombinant Human C8orf34 Protein, GST-Tagged
| Cat.No. : | C8orf34-0160H |
| Product Overview : | Human C8orf34 full-length ORF (NP_443190.1, 1 a.a. - 427 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein that is related to the cyclic AMP dependent protein kinase regulators. Naturally occurring mutations in this gene are associated with an increased risk for severe toxicities, such as diarrhea and neutropenia, in patients undergoing chemotherapeutic treatment. [provided by RefSeq, Mar 2017] |
| Molecular Mass : | 74 kDa |
| AA Sequence : | MTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESEKSESKGTRRDFRSYDKPWQLNAKKPKKSKSDLAVSNISPPSPDSKSLPRSVEHPKWNWRTKPQSRDFDELNHILQESKKLGKALENLSRSIAISDELDKETVTFNSSLLRPRVIGEWIGREENDADPLAAEMLQPPIPRSKNDQWESEDSGSSPAGSLKMEPKNKGLKQQQQQHKKLLAAMLSQDSFESIHSPTPSVTEEDIDNEDDAMELLEDLNDLRMEGVTTLVPSGSKFNQGRPTYPAEPQAKVTLNICSRCARLQGDNLEERTEESLPILHSPDEKIPDSFDSLPGTEEALMEEGDEFEKASKLTGPGEASSGVGHSLKNYMEEDESLKQLQVVHQPWILPSDTESEGVEAEQEKRSADLLLCVPCSSCPTLVYSGL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C8orf34 chromosome 8 open reading frame 34 [ Homo sapiens ] |
| Official Symbol | C8orf34 |
| Synonyms | C8ORF34; chromosome 8 open reading frame 34; uncharacterized protein C8orf34; vest 1; VEST1; vestibule 1; protein VEST-1; vestibule-1 protein; VEST-1; FLJ36872; FLJ37331; DKFZp547E186; |
| Gene ID | 116328 |
| mRNA Refseq | NM_001195639 |
| Protein Refseq | NP_001182568 |
| UniProt ID | Q49A92 |
| ◆ Recombinant Proteins | ||
| C8orf34-0160H | Recombinant Human C8orf34 Protein, GST-Tagged | +Inquiry |
| C8orf34-2638HF | Recombinant Full Length Human C8orf34 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C8orf34 Products
Required fields are marked with *
My Review for All C8orf34 Products
Required fields are marked with *
