Recombinant Human C9 protein, His-GST-tagged
Cat.No. : | C9-5142H |
Product Overview : | Recombinant Human C9 protein(P02748)(74-155aa), fused with N-terminal His and GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 74-155aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 40.7 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | NGKRCTDAVGDRRQCVPTEPCEDAEDDCGNDFQCSTGRCIKMRLRCNGDNDCGDFSDEDDCESEPRPPCRDRVVEESELART |
Gene Name | C9 complement component 9 [ Homo sapiens ] |
Official Symbol | C9 |
Synonyms | C9; complement component 9; complement component C9; |
Gene ID | 735 |
mRNA Refseq | NM_001737 |
Protein Refseq | NP_001728 |
MIM | 120940 |
UniProt ID | P02748 |
◆ Recombinant Proteins | ||
RFL28089EF | Recombinant Full Length Horse Complement Component C9(C9) Protein, His-Tagged | +Inquiry |
C9-0274H | Recombinant Human C9 Protein (Gln22-His265), N-His-tagged | +Inquiry |
C9-714R | Recombinant Rat C9 Protein, His (Fc)-Avi-tagged | +Inquiry |
C9-04R | Recombinant Rat C9 Protein | +Inquiry |
C9-44HF | Recombinant Full Length Human C9 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
C9-58H | Native Human Complement C9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
C9-7945HCL | Recombinant Human C9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C9 Products
Required fields are marked with *
My Review for All C9 Products
Required fields are marked with *
0
Inquiry Basket