Recombinant Human C9orf72 protein, His-tagged
| Cat.No. : | C9orf72-2915H |
| Product Overview : | Recombinant Human C9orf72 protein(1-221 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | December 16, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-221 aa |
| Tag : | N-His |
| Form : | Liquid in sterile PBS, pH7.4, 10% Glycerol. |
| Molecular Mass : | The protein has a calculated MW of 29 kDa. |
| Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
| Purity : | > 90 % as determined by SDS-PAGE. |
| Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1.0 mg/ml. |
| Reconstitution : | Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | MGSSHHHHHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMSTLCPPPSPAVAKTEIALSGKSPLLAATFAYWDNILGPRVRHIWAPKTEQVLLSDGEITFLANHTLNGEILRNAESGAIDVKFFVLSEKGVIIVSLIFDGNWNGDRSTYGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQGQSIIPMLTGEVIPVMELLSSMKSHSVPEEIDIADTVLNDDDIGDSCHEGFLL |
| ◆ Recombinant Proteins | ||
| C9orf72-678HFL | Recombinant Full Length Human C9orf72 Protein, N-His-tagged | +Inquiry |
| C9orf72-2037H | Recombinant Human C9orf72 Protein, His-tagged | +Inquiry |
| C9orf72-2915H | Recombinant Human C9orf72 protein, His-tagged | +Inquiry |
| C9orf72-0211H | Recombinant Human C9orf72 Protein, GST-Tagged | +Inquiry |
| C9orf72-2232H | Recombinant Human C9orf72 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C9orf72 Products
Required fields are marked with *
My Review for All C9orf72 Products
Required fields are marked with *
