Recombinant Human CA5B Protein, GST-Tagged
Cat.No. : | CA5B-0243H |
Product Overview : | Human CA5B full-length ORF (AAH28142, 1 a.a. - 317 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA VB is localized in the mitochondria and shows the highest sequence similarity to the other mitochondrial CA, CA VA. It has a wider tissue distribution than CA VA, which is restricted to the liver. The differences in tissue distribution suggest that the two mitochondrial carbonic anhydrases evolved to assume different physiologic roles. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 60.61 kDa |
AA Sequence : | MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CA5B carbonic anhydrase VB, mitochondrial [ Homo sapiens ] |
Official Symbol | CA5B |
Synonyms | CA5B; carbonic anhydrase VB, mitochondrial; carbonic anhydrase 5B, mitochondrial; carbonic dehydratase; carbonate dehydratase VB; CA-VB; MGC39962; |
Gene ID | 11238 |
mRNA Refseq | NM_007220 |
Protein Refseq | NP_009151 |
MIM | 300230 |
UniProt ID | Q9Y2D0 |
◆ Recombinant Proteins | ||
CA5B-0243H | Recombinant Human CA5B Protein, GST-Tagged | +Inquiry |
CAR5B-1135R | Recombinant Rat CAR5B Protein | +Inquiry |
Ca5b-7838R | Recombinant Rat Ca5b protein, His-tagged | +Inquiry |
CA5B-463H | Recombinant Human CA5B Protein | +Inquiry |
CA5B-10623H | Recombinant Human CA5B, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA5B-265HCL | Recombinant Human CA5B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CA5B Products
Required fields are marked with *
My Review for All CA5B Products
Required fields are marked with *
0
Inquiry Basket