Recombinant Human CABLES2 Protein, GST-Tagged
Cat.No. : | CABLES2-0257H |
Product Overview : | Human CABLES2 partial ORF (NP_112492, 131 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CABLES2 (Cdk5 And Abl Enzyme Substrate 2) is a Protein Coding gene. Among its related pathways are Factors involved in megakaryocyte development and platelet production and Response to elevated platelet cytosolic Ca2+. GO annotations related to this gene include cyclin-dependent protein serine/threonine kinase regulator activity. An important paralog of this gene is CABLES1. |
Molecular Mass : | 37.73 kDa |
AA Sequence : | LEFLEDAVGCAPAQRTKHTSGSPRHKGLKKTHFIKNMRQYDTRNSRIVLICAKRSLCAAFSVLPYGEGLRISDLRVDSQKQRHPSGGVSVSSEMVFELEGVELGADGKV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CABLES2 Cdk5 and Abl enzyme substrate 2 [ Homo sapiens ] |
Official Symbol | CABLES2 |
Synonyms | CABLES2; Cdk5 and Abl enzyme substrate 2; C20orf150, chromosome 20 open reading frame 150; CDK5 and ABL1 enzyme substrate 2; dJ908M14.2; ik3 2; interactor with CDK3 2; ik3-2; C20orf150; |
Gene ID | 81928 |
mRNA Refseq | NM_031215 |
Protein Refseq | NP_112492 |
UniProt ID | Q9BTV7 |
◆ Recombinant Proteins | ||
CABLES2-0257H | Recombinant Human CABLES2 Protein, GST-Tagged | +Inquiry |
CABLES2-1362H | Active Recombinant Human ABL2, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CABLES2 Products
Required fields are marked with *
My Review for All CABLES2 Products
Required fields are marked with *