"CABLES2" Related Products

Recombinant Human CABLES2 Protein, GST-Tagged

Cat.No. : CABLES2-0257H
Product Overview : Human CABLES2 partial ORF (NP_112492, 131 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal.
Description : CABLES2 (Cdk5 And Abl Enzyme Substrate 2) is a Protein Coding gene. Among its related pathways are Factors involved in megakaryocyte development and platelet production and Response to elevated platelet cytosolic Ca2+. GO annotations related to this gene include cyclin-dependent protein serine/threonine kinase regulator activity. An important paralog of this gene is CABLES1.
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 37.73 kDa
AA Sequence : LEFLEDAVGCAPAQRTKHTSGSPRHKGLKKTHFIKNMRQYDTRNSRIVLICAKRSLCAAFSVLPYGEGLRISDLRVDSQKQRHPSGGVSVSSEMVFELEGVELGADGKV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : CABLES2 Cdk5 and Abl enzyme substrate 2 [ Homo sapiens ]
Official Symbol : CABLES2
Synonyms : CABLES2; Cdk5 and Abl enzyme substrate 2; C20orf150, chromosome 20 open reading frame 150; CDK5 and ABL1 enzyme substrate 2; dJ908M14.2; ik3 2; interactor with CDK3 2; ik3-2; C20orf150;
Gene ID : 81928
mRNA Refseq : NM_031215
Protein Refseq : NP_112492
UniProt ID : Q9BTV7

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.