Recombinant Human CABLES2 Protein, GST-Tagged

Cat.No. : CABLES2-0257H
Product Overview : Human CABLES2 partial ORF (NP_112492, 131 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CABLES2 (Cdk5 And Abl Enzyme Substrate 2) is a Protein Coding gene. Among its related pathways are Factors involved in megakaryocyte development and platelet production and Response to elevated platelet cytosolic Ca2+. GO annotations related to this gene include cyclin-dependent protein serine/threonine kinase regulator activity. An important paralog of this gene is CABLES1.
Molecular Mass : 37.73 kDa
AA Sequence : LEFLEDAVGCAPAQRTKHTSGSPRHKGLKKTHFIKNMRQYDTRNSRIVLICAKRSLCAAFSVLPYGEGLRISDLRVDSQKQRHPSGGVSVSSEMVFELEGVELGADGKV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CABLES2 Cdk5 and Abl enzyme substrate 2 [ Homo sapiens ]
Official Symbol CABLES2
Synonyms CABLES2; Cdk5 and Abl enzyme substrate 2; C20orf150, chromosome 20 open reading frame 150; CDK5 and ABL1 enzyme substrate 2; dJ908M14.2; ik3 2; interactor with CDK3 2; ik3-2; C20orf150;
Gene ID 81928
mRNA Refseq NM_031215
Protein Refseq NP_112492
UniProt ID Q9BTV7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CABLES2 Products

Required fields are marked with *

My Review for All CABLES2 Products

Required fields are marked with *

0
cart-icon