Recombinant Human CACNA1C Protein, GST-Tagged
Cat.No. : | CACNA1C-0264H |
Product Overview : | Human CACNA1C partial ORF (NP_000710, 2039 a.a. - 2138 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an alpha-1 subunit of a voltage-dependent calcium channel. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization. The alpha-1 subunit consists of 24 transmembrane segments and forms the pore through which ions pass into the cell. The calcium channel consists of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. There are multiple isoforms of each of these proteins, either encoded by different genes or the result of alternative splicing of transcripts. The protein encoded by this gene binds to and is inhibited by dihydropyridine. Alternative splicing results in many transcript variants encoding different proteins. Some of the predicted proteins may not produce functional ion channel subunits. [provided by RefSeq, Oct 2012] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | AVLISEGLGQFAQDPKFIEVTTQELADACDMTIEEMESAADNILSGGAPQSPNGALLPFVNCRDAGQDRAGGEEDAGCVRARGRPSEEELQDSRVYVSSL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CACNA1C calcium channel, voltage-dependent, L type, alpha 1C subunit [ Homo sapiens ] |
Official Symbol | CACNA1C |
Synonyms | CACNA1C; calcium channel, voltage-dependent, L type, alpha 1C subunit; CACNL1A1, CCHL1A1; voltage-dependent L-type calcium channel subunit alpha-1C; CACH2; CACN2; Cav1.2; TS; DHPR, alpha-1 subunit; calcium channel, cardic dihydropyridine-sensitive, alpha-1 subunit; calcium channel, L type, alpha-1 polypeptide, isoform 1, cardiac muscle; voltage-gated L-type calcium channel Cav1.2 alpha 1 subunit, splice variant 10*; CaV1.2; CCHL1A1; CACNL1A1; MGC120730; |
Gene ID | 775 |
mRNA Refseq | NM_000719 |
Protein Refseq | NP_000710 |
MIM | 114205 |
UniProt ID | Q13936 |
◆ Recombinant Proteins | ||
RFL29137CF | Recombinant Full Length Guinea Pig Voltage-Dependent L-Type Calcium Channel Subunit Alpha-1C(Cacna1C) Protein, His-Tagged | +Inquiry |
Cacna1c-1423M | Recombinant Mouse Cacna1c protein, His & T7-tagged | +Inquiry |
CACNA1C-0264H | Recombinant Human CACNA1C Protein, GST-Tagged | +Inquiry |
CACNA1C-01G | Recombinant Guinea pig CACNA1C Full Length Transmembrane protein, His-tagged | +Inquiry |
CACNA1C-117H | Recombinant Human CACNA1C protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CACNA1C Products
Required fields are marked with *
My Review for All CACNA1C Products
Required fields are marked with *