Recombinant Human CACNA1C protein, His-tagged
| Cat.No. : | CACNA1C-117H | 
| Product Overview : | Recombinant Human CACNA1C protein(Q13936)(Glu431-Asn510), fused with C-terminal His tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | Glu431-Asn510 | 
| Tag : | C-His | 
| Form : | Phosphate buffered saline. | 
| Molecular Mass : | 12 kDa | 
| Storage : | Store at -20°C to -80°C. | 
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. | 
| AA Sequence : | EEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWN | 
| Gene Name | CACNA1C calcium channel, voltage-dependent, L type, alpha 1C subunit [ Homo sapiens ] | 
| Official Symbol | CACNA1C | 
| Synonyms | CACNA1C; calcium channel, voltage-dependent, L type, alpha 1C subunit; CACNL1A1, CCHL1A1; voltage-dependent L-type calcium channel subunit alpha-1C; CACH2; CACN2; Cav1.2; TS; DHPR, alpha-1 subunit; calcium channel, cardic dihydropyridine-sensitive, alpha-1 subunit; calcium channel, L type, alpha-1 polypeptide, isoform 1, cardiac muscle; voltage-gated L-type calcium channel Cav1.2 alpha 1 subunit, splice variant 10*; CaV1.2; CCHL1A1; CACNL1A1; MGC120730; | 
| Gene ID | 775 | 
| mRNA Refseq | NM_000719 | 
| Protein Refseq | NP_000710 | 
| MIM | 114205 | 
| UniProt ID | Q13936 | 
| ◆ Recombinant Proteins | ||
| Cacna1c-1423M | Recombinant Mouse Cacna1c protein, His & T7-tagged | +Inquiry | 
| CACNA1C-9399Z | Recombinant Zebrafish CACNA1C | +Inquiry | 
| RFL11969GF | Recombinant Full Length Chicken Voltage-Dependent L-Type Calcium Channel Subunit Alpha-1C(Cacna1C) Protein, His-Tagged | +Inquiry | 
| CACNA1C-0264H | Recombinant Human CACNA1C Protein, GST-Tagged | +Inquiry | 
| CACNA1C-117H | Recombinant Human CACNA1C protein, His-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CACNA1C Products
Required fields are marked with *
My Review for All CACNA1C Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            