Recombinant Human CACNA1C protein, His-tagged

• Cat.No.: CACNA1C-117H
• Product Overview: Recombinant Human CACNA1C protein(Q13936)(Glu431-Asn510), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Glu431-Asn510
• Tag: C-His
• Form: Phosphate buffered saline.
• Molecular Mass: 12 kDa
• Storage: Store at -20°C to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: EEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWN

Gene Information

• Gene Name: CACNA1C calcium channel, voltage-dependent, L type, alpha 1C subunit [ Homo sapiens ]
• Official Symbol: CACNA1C
• Synonyms: CACNA1C; calcium channel, voltage-dependent, L type, alpha 1C subunit; CACNL1A1, CCHL1A1; voltage-dependent L-type calcium channel subunit alpha-1C; CACH2; CACN2; Cav1.2; TS; DHPR, alpha-1 subunit; calcium channel, cardic dihydropyridine-sensitive, alpha-1 subunit; calcium channel, L type, alpha-1 polypeptide, isoform 1, cardiac muscle; voltage-gated L-type calcium channel Cav1.2 alpha 1 subunit, splice variant 10*; CaV1.2; CCHL1A1; CACNL1A1; MGC120730
• Gene ID: 775
• mRNA Refseq: NM_000719
• Protein Refseq: NP_000710
• MIM: 114205
• UniProt ID: Q13936