Recombinant Human CACNA1I Protein, GST-Tagged

Cat.No. : CACNA1I-0267H
Product Overview : Human CACNA1I partial ORF (NP_066919, 233 a.a. - 331 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes the pore-forming alpha subunit of a voltage gated calcium channel. The encoded protein is a member of a subfamily of calcium channels referred to as is a low voltage-activated, T-type, calcium channel. The channel encoded by this protein is characterized by a slower activation and inactivation compared to other T-type calcium channels. This protein may be involved in calcium signaling in neurons. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2011]
Molecular Mass : 36.63 kDa
AA Sequence : GLLRNRCFLEENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDVYDFGAGRQDLNASGLCVNWNRYYNVCRTGSA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CACNA1I calcium channel, voltage-dependent, T type, alpha 1I subunit [ Homo sapiens ]
Official Symbol CACNA1I
Synonyms CACNA1I; calcium channel, voltage-dependent, T type, alpha 1I subunit; voltage-dependent T-type calcium channel subunit alpha-1I; Cav3.3; voltage-gated calcium channel subunit alpha Cav3.3; calcium channel, voltage-dependent, alpha 1I subunit; ca(v)3.3; KIAA1120;
Gene ID 8911
mRNA Refseq NM_001003406
Protein Refseq NP_001003406
MIM 608230
UniProt ID Q9P0X4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CACNA1I Products

Required fields are marked with *

My Review for All CACNA1I Products

Required fields are marked with *

0

Inquiry Basket

cartIcon