Recombinant Human CACNA1I Protein, GST-Tagged
Cat.No. : | CACNA1I-0267H |
Product Overview : | Human CACNA1I partial ORF (NP_066919, 233 a.a. - 331 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes the pore-forming alpha subunit of a voltage gated calcium channel. The encoded protein is a member of a subfamily of calcium channels referred to as is a low voltage-activated, T-type, calcium channel. The channel encoded by this protein is characterized by a slower activation and inactivation compared to other T-type calcium channels. This protein may be involved in calcium signaling in neurons. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2011] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | GLLRNRCFLEENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDVYDFGAGRQDLNASGLCVNWNRYYNVCRTGSA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CACNA1I calcium channel, voltage-dependent, T type, alpha 1I subunit [ Homo sapiens ] |
Official Symbol | CACNA1I |
Synonyms | CACNA1I; calcium channel, voltage-dependent, T type, alpha 1I subunit; voltage-dependent T-type calcium channel subunit alpha-1I; Cav3.3; voltage-gated calcium channel subunit alpha Cav3.3; calcium channel, voltage-dependent, alpha 1I subunit; ca(v)3.3; KIAA1120; |
Gene ID | 8911 |
mRNA Refseq | NM_001003406 |
Protein Refseq | NP_001003406 |
MIM | 608230 |
UniProt ID | Q9P0X4 |
◆ Recombinant Proteins | ||
CACNA1I-729R | Recombinant Rat CACNA1I Protein, His (Fc)-Avi-tagged | +Inquiry |
CACNA1I-118H | Recombinant Human CACNA1I protein, His-tagged | +Inquiry |
CACNA1I-1065R | Recombinant Rat CACNA1I Protein | +Inquiry |
CACNA1I-0267H | Recombinant Human CACNA1I Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CACNA1I Products
Required fields are marked with *
My Review for All CACNA1I Products
Required fields are marked with *