Recombinant Human CACNA1I protein, His-tagged
Cat.No. : | CACNA1I-118H |
Product Overview : | Recombinant Human CACNA1I protein(Q9P0X4)(His1831-Gly1900), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | His1831-Gly1900 |
Tag : | C-His |
Form : | Phosphate buffered saline. |
Molecular Mass : | 10 kDa |
Storage : | Store at -20°C to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | HYSSPAGCKKCHHDKQEVQLAETEAFSLNSDRSSSILLGDDLSLEDPTACPPGRKDSKGELDPPEPMRVG |
Gene Name | CACNA1I calcium channel, voltage-dependent, T type, alpha 1I subunit [ Homo sapiens ] |
Official Symbol | CACNA1I |
Synonyms | CACNA1I; calcium channel, voltage-dependent, T type, alpha 1I subunit; voltage-dependent T-type calcium channel subunit alpha-1I; Cav3.3; voltage-gated calcium channel subunit alpha Cav3.3; calcium channel, voltage-dependent, alpha 1I subunit; ca(v)3.3; KIAA1120; |
Gene ID | 8911 |
mRNA Refseq | NM_001003406 |
Protein Refseq | NP_001003406 |
MIM | 608230 |
UniProt ID | Q9P0X4 |
◆ Recombinant Proteins | ||
CACNA1I-0267H | Recombinant Human CACNA1I Protein, GST-Tagged | +Inquiry |
CACNA1I-1065R | Recombinant Rat CACNA1I Protein | +Inquiry |
CACNA1I-118H | Recombinant Human CACNA1I protein, His-tagged | +Inquiry |
CACNA1I-729R | Recombinant Rat CACNA1I Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CACNA1I Products
Required fields are marked with *
My Review for All CACNA1I Products
Required fields are marked with *
0
Inquiry Basket