Recombinant Human CACNA1I protein, His-tagged

• Cat.No.: CACNA1I-118H
• Product Overview: Recombinant Human CACNA1I protein(Q9P0X4)(His1831-Gly1900), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: His1831-Gly1900
• Tag: C-His
• Form: Phosphate buffered saline.
• Molecular Mass: 10 kDa
• Storage: Store at -20°C to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: HYSSPAGCKKCHHDKQEVQLAETEAFSLNSDRSSSILLGDDLSLEDPTACPPGRKDSKGELDPPEPMRVG

Gene Information

• Gene Name: CACNA1I calcium channel, voltage-dependent, T type, alpha 1I subunit [ Homo sapiens ]
• Official Symbol: CACNA1I
• Synonyms: CACNA1I; calcium channel, voltage-dependent, T type, alpha 1I subunit; voltage-dependent T-type calcium channel subunit alpha-1I; Cav3.3; voltage-gated calcium channel subunit alpha Cav3.3; calcium channel, voltage-dependent, alpha 1I subunit; ca(v)3.3; KIAA1120
• Gene ID: 8911
• mRNA Refseq: NM_001003406
• Protein Refseq: NP_001003406
• MIM: 608230
• UniProt ID: Q9P0X4