Recombinant Human CACNA2D2 Protein, GST-Tagged

Cat.No. : CACNA2D2-0269H
Product Overview : Human CACNA2D2 partial ORF (NP_006021, 65 a.a. - 162 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Calcium channels mediate the entry of calcium ions into the cell upon membrane polarization. This gene encodes the alpha-2/delta subunit of the voltage-dependent calcium channel complex. The complex consists of the main channel-forming subunit alpha-1, and auxiliary subunits alpha-2/delta, beta, and gamma. The auxiliary subunits function in the assembly and membrane localization of the complex, and modulate calcium currents and channel activation/inactivation kinetics. The subunit encoded by this gene undergoes post-translational cleavage to yield the extracellular alpha2 peptide and a membrane-anchored delta polypeptide. This subunit is a receptor for the antiepileptic drug, gabapentin. Mutations in this gene are associated with early infantile epileptic encephalopathy. Single nucleotide polymorphisms in this gene are correlated with increased sensitivity to opioid drugs. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2014]
Molecular Mass : 36.52 kDa
AA Sequence : PQQHTMQHWARRLEQEVDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVAGDIESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDIVYY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CACNA2D2 calcium channel, voltage-dependent, alpha 2/delta subunit 2 [ Homo sapiens ]
Official Symbol CACNA2D2
Synonyms CACNA2D2; calcium channel, voltage-dependent, alpha 2/delta subunit 2; voltage-dependent calcium channel subunit alpha-2/delta-2; gene 26; KIAA0558; alpha 2 delta calcium channel subunit; voltage-gated calcium channel subunit alpha-2/delta-2; CACNA2D; LUAC11.1;
Gene ID 9254
mRNA Refseq NM_001005505
Protein Refseq NP_001005505
MIM 607082
UniProt ID Q9NY47

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CACNA2D2 Products

Required fields are marked with *

My Review for All CACNA2D2 Products

Required fields are marked with *

0
cart-icon