Recombinant Human CACNG2 protein, His-tagged
| Cat.No. : | CACNG2-5655H |
| Product Overview : | Recombinant Human CACNG2 protein(146-323 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 146-323 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | GLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSFYFGALSFIIAEMVGVLAVHMFIDRHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSSSRSTEPSHSRDASPVGIKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVHNCIQKENKDSLHSNTANRRTTPV |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | CACNG2 calcium channel, voltage-dependent, gamma subunit 2 [ Homo sapiens ] |
| Official Symbol | CACNG2 |
| Synonyms | CACNG2; calcium channel, voltage-dependent, gamma subunit 2; voltage-dependent calcium channel gamma-2 subunit; MGC138502; MGC138504; stargazin; TARP gamma-2; transmembrane AMPAR regulatory protein gamma-2; neuronal voltage-gated calcium channel gamma-2 subunit; MRD10; FLJ41437; |
| Gene ID | 10369 |
| mRNA Refseq | NM_006078 |
| Protein Refseq | NP_006069 |
| MIM | 602911 |
| UniProt ID | Q9Y698 |
| ◆ Recombinant Proteins | ||
| CACNG2-10642H | Recombinant Human CACNG2, His-tagged | +Inquiry |
| RFL27005HF | Recombinant Full Length Human Voltage-Dependent Calcium Channel Gamma-2 Subunit(Cacng2) Protein, His-Tagged | +Inquiry |
| RFL33398RF | Recombinant Full Length Rat Voltage-Dependent Calcium Channel Gamma-2 Subunit(Cacng2) Protein, His-Tagged | +Inquiry |
| CACNG2-1175M | Recombinant Mouse CACNG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CACNG2-2624M | Recombinant Mouse CACNG2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CACNG2-7901HCL | Recombinant Human CACNG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CACNG2 Products
Required fields are marked with *
My Review for All CACNG2 Products
Required fields are marked with *
