Recombinant Human CACNG2 protein, His-tagged
Cat.No. : | CACNG2-5655H |
Product Overview : | Recombinant Human CACNG2 protein(146-323 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 146-323 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | GLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSFYFGALSFIIAEMVGVLAVHMFIDRHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSSSRSTEPSHSRDASPVGIKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVHNCIQKENKDSLHSNTANRRTTPV |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | CACNG2 calcium channel, voltage-dependent, gamma subunit 2 [ Homo sapiens ] |
Official Symbol | CACNG2 |
Synonyms | CACNG2; calcium channel, voltage-dependent, gamma subunit 2; voltage-dependent calcium channel gamma-2 subunit; MGC138502; MGC138504; stargazin; TARP gamma-2; transmembrane AMPAR regulatory protein gamma-2; neuronal voltage-gated calcium channel gamma-2 subunit; MRD10; FLJ41437; |
Gene ID | 10369 |
mRNA Refseq | NM_006078 |
Protein Refseq | NP_006069 |
MIM | 602911 |
UniProt ID | Q9Y698 |
◆ Cell & Tissue Lysates | ||
CACNG2-7901HCL | Recombinant Human CACNG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CACNG2 Products
Required fields are marked with *
My Review for All CACNG2 Products
Required fields are marked with *
0
Inquiry Basket