Recombinant Human CALCB Protein, GST-tagged

• Cat.No.: CALCB-818H
• Product Overview: Recombinant Human CALCB fused with GST tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Description: CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role.
• Form: Supplied as a 0.2 µM filtered solution of PBS, pH 7.4, 50% glycerol
• Molecular Mass: 40.9kD
• AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSENLYFQGHMGFRKFSPFLALSILVLYQAG
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining

Gene Information

• Gene Name: CALCB calcitonin-related polypeptide beta [ Homo sapiens ]
• Official Symbol: CALCB
• Synonyms: CALCB; calcitonin-related polypeptide beta; CALC2, calcitonin 2; calcitonin gene-related peptide 2; CGRP II; FLJ30166; beta-CGRP; calcitonin 2; beta-type CGRP; calcitonin gene-related peptide II; CALC2; CGRP2; CGRP-II
• Gene ID: 797
• mRNA Refseq: NM_000728
• Protein Refseq: NP_000719
• MIM: 114160
• UniProt ID: P10092