Recombinant Human CALCB Protein, GST-tagged

Cat.No. : CALCB-818H
Product Overview : Recombinant Human CALCB fused with GST tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Description : CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role.
Form : Supplied as a 0.2 µM filtered solution of PBS, pH 7.4, 50% glycerol
Molecular Mass : 40.9kD
AA Sequence : MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSENLYFQGHMGFRKFSPFLALSILVLYQAG
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Gene Name CALCB calcitonin-related polypeptide beta [ Homo sapiens ]
Official Symbol CALCB
Synonyms CALCB; calcitonin-related polypeptide beta; CALC2, calcitonin 2; calcitonin gene-related peptide 2; CGRP II; FLJ30166; beta-CGRP; calcitonin 2; beta-type CGRP; calcitonin gene-related peptide II; CALC2; CGRP2; CGRP-II;
Gene ID 797
mRNA Refseq NM_000728
Protein Refseq NP_000719
MIM 114160
UniProt ID P10092

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CALCB Products

Required fields are marked with *

My Review for All CALCB Products

Required fields are marked with *

0
cart-icon
0
compare icon