Recombinant Human CALR protein, GST-tagged
Cat.No. : | CALR-301231H |
Product Overview : | Recombinant Human CALR (248-417 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Lys248-Leu417 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | KKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CALR calreticulin [ Homo sapiens ] |
Official Symbol | CALR |
Synonyms | CALR; calreticulin; autoantigen Ro; cC1qR; CRT; FLJ26680; RO; Sicca syndrome antigen A (autoantigen Ro; calreticulin); SSA; CRP55; ERp60; HACBP; grp60; calregulin; endoplasmic reticulum resident protein 60; Sicca syndrome antigen A (autoantigen Ro; calreticulin); |
Gene ID | 811 |
mRNA Refseq | NM_004343 |
Protein Refseq | NP_004334 |
MIM | 109091 |
UniProt ID | P27797 |
◆ Recombinant Proteins | ||
CALR-8593H | Recombinant Human CALR, Fc tagged | +Inquiry |
CALR-5643H | Recombinant Human CALR protein, His&Flag-tagged | +Inquiry |
Calr-1438M | Recombinant Mouse Calr protein, SKIK-His-tagged | +Inquiry |
CALR-377M | Recombinant Mouse CALR Protein (18-416 aa), GST-tagged | +Inquiry |
CALR-1433C | Recombinant Chinese hamster CALR protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALR-1222HCL | Recombinant Human CALR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALR Products
Required fields are marked with *
My Review for All CALR Products
Required fields are marked with *
0
Inquiry Basket