Recombinant Human CALR protein, GST-tagged
| Cat.No. : | CALR-301231H |
| Product Overview : | Recombinant Human CALR (248-417 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Lys248-Leu417 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | KKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CALR calreticulin [ Homo sapiens ] |
| Official Symbol | CALR |
| Synonyms | CALR; calreticulin; autoantigen Ro; cC1qR; CRT; FLJ26680; RO; Sicca syndrome antigen A (autoantigen Ro; calreticulin); SSA; CRP55; ERp60; HACBP; grp60; calregulin; endoplasmic reticulum resident protein 60; Sicca syndrome antigen A (autoantigen Ro; calreticulin); |
| Gene ID | 811 |
| mRNA Refseq | NM_004343 |
| Protein Refseq | NP_004334 |
| MIM | 109091 |
| UniProt ID | P27797 |
| ◆ Recombinant Proteins | ||
| CALR-356C | Recombinant Cynomolgus CALR Protein, His-tagged | +Inquiry |
| CALR-2130P | Recombinant Pig CALR Protein (18-417 aa), His-tagged | +Inquiry |
| CALR-0216H | Recombinant Human CALR Protein, Tag Free | +Inquiry |
| CALR-8675Z | Recombinant Zebrafish CALR | +Inquiry |
| CALR-488H | Recombinant Human CALR Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CALR-1222HCL | Recombinant Human CALR cell lysate | +Inquiry |
| CALR-080HKCL | Human CALR Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALR Products
Required fields are marked with *
My Review for All CALR Products
Required fields are marked with *
